Informacije

Koliki je naboj oligonukleotida 5 'pGpGpApCpT 3' pri pH 7,00?


Koliki je naboj na nukleotidu 5'pGpGpApCpT 3 ' @ pH 7,00?

Mislio sam da adenin ima 1NHgrupa i Guanine imaNHiOHgrupe i citozin i timinOHgrupe na njemu i fosfati na 5 'kraju anOHna 3 'kraju. tako na pH 2,00-3,00OHće dati elektron i postati negativno nabijen.pa je li to +2 +2-1-1-1 što je -1? molimo objasnite?


Nisam baš razumio odakle vam sve vaše OH grupe, možda iz enolnih tuatomera nukleotida. Pokušao sam potražiti pKa za keto tautomere nukleotida na Wikipediji1,2,3,4.

Općenito, ako je pH ispod pKa funkcionalne grupe, ta će se grupa protonirati, a ako je pH iznad pKa, deprotonirat će se, iako je to ravnoteža.

Ako pretpostavimo pH 7 i pretpostavimo da imam pKas u pravu (ove vrijednosti su za slobodne nukleinske kiseline, bez deoksiriboze vezane), tada će primarni amini na A, G i C biti protonizirane NH3 grupe s pozitivnim nabojem. Amidi na G i T trebaju ostati deprotonirani i nenapunjeni.

Dakle, sa sekvencom GGACT imamo 4 primarna amina, dakle 4 pozitivna naboja. Međutim, imamo i 5 fosfata, od kojih svaki nosi negativan naboj, pa je +4 plus -5 -1.

Naravno, sve ovo izlazi kroz prozor kada vežemo taj oligonukleotid za drugi oligonukleotid, pretpostavljam da će vodonična veza promijeniti pKas i naboje. Koliko ja znam, jednostavno vezivanje nukleinskih kiselina na deoksiribozu i njihovo slaganje zajedno mijenja pKas.


Na bazi nema pozitivnog naboja na pH 7, ali postoje 4 veze fosfodiestera koje imaju -1 naboj na svakom fosfatu, tako da je ukupno -4 i završni fosfat na 5 'kraju slobodan, pa ima naboj -2. Tako je ukupni naboj oligonukleotida -4-2 = -6 (određen brojem fosfatnih grupa)


Na bazi nema pozitivnog naboja pri pH 7, pa je ukupni naboj oligonukleotida -4 (određen brojem fosfatnih grupa) ... Detalje pogledajte ovdje: https://books.google.cz/books?id=v9HL5VyRmZcC&lpg = PA204 & ots = DQYKZ9PxXg & dq = zašto%20amino%20grupa%20od%20nukleo%20baze%20protonirano & pg = PA204#v = jedna stranica & q = zašto%20amino%20grupa%20od%20nukleo%20baze%20protonirano & f = lažno


Vezivanje i biomimetičko cijepanje RNA poli (U) sintetičkim poliimidazolima

Četiri poliimidazola korištena su u studijama vezivanja i cijepanja s poli (U). Dva polidisperzna polivinilimidazola prethodno su opisali drugi, dok su druga dva nova polimera polietilenimina pripremljena kationskom polimerizacijom oksazolina. Potonji je imao imidazolne jedinice vezane za svaki dušik polimera. Karakterizirala ih je hromatografija prožimanja gela i imala su vrlo niske polidisperznosti. Kad su djelomično protonirani, vezali su se za poli (U) i katalizirali njegovo cijepanje postupkom analognim onom koji koristi enzim ribonukleaza A. Nakon kinetike cijepanja uslijedio je test koji smo prethodno opisali pomoću fosfodiesteraze I iz Crotalus otrov nakon procesa cijepanja. Ispitivano je i cijepanje poli (U) sa Zn 2+, sa i bez polimera. Opisana je shema u kojoj se ova cijepanja mogu učiniti selektivno sekvenciranim s različitim RNK, posebno sa važnim ciljevima, poput virusnih RNK.

Polimerni karakter prirodnih enzima potaknuo nas je da proširimo polje umjetnih enzima na one na bazi sintetičkih polimera, kako smo ranije izvijestili (1). Posebno bi bili važni umjetni enzimi koji bi mogli cijepati RNK, po mogućnosti sa specifičnošću sekvence (2, 3). Oni bi se potencijalno mogli upotrijebiti za uništavanje opasnih molekula virusne RNA ako na polimere pričvrstimo kratku DNK sa potrebnom sekvencom za selektivno vezivanje. To bi bio napredak u molekularnoj medicini korištenjem aktivnog katalizatora, a ne samo modifikatorom bioloških sistema, kao što je tipično za druge lijekove.

Opisali smo analitičku metodu za praćenje brzina cijepanja RNA (4) različitim katalizatorima ili reaktantima koji imitiraju mehanizam koji koristi ribonukleaza A. U ovom enzimu, C-2 ′ hidroksilna grupa riboze napada susjedni fosfat koji povezuje C-3 ′ hidroksil sa C-5 ′ hidroksil druge riboze. Rezultat je stvaranje C-2 ′/C-3 ′ cikličnog fosfata i oslobođena C-5 ′ hidroksilna grupa. Zatim proizvod tretiramo fosfodiesterazom I iz Crotalus otrov, koji cijepa RNA na drugačiji način, hidrolizirajući preostalu C-3 ′/C-5 ′ fosfatnu vezu kako bi uklonio fosfat iz C-3 ′ i ostavio je na C-5 ′. S RNK, svi produkti drugog koraka su nukleotidni 5 ′-fosfati, osim onih u kojima je zbog cijepanja sličnog ribonukleazi položaj 5 ′ ostavljen nefosforiliran. S poli (U) kao supstratom, svako početno mjesto cijepanja nalik ribonukleazi ostavlja nefosforilirani uridin nakon tretmana fosfodiesteraze I, što smo ispitali kvantitativnom HPLC. Pokazali smo da je ovaj test za cijepanje RNA-sličnog RNAza kvantitativno pouzdan (4).

U ribonukleazi A, cijepanje kataliziraju imidazolni prstenovi dva histidina, jedan manje bazičan kao slobodna baza imidazola (His-12), a drugi bazičniji kao imidazolijev kation (His-119) (5). U najvjerojatnijem mehanizmu (6), imidazol His-12 deprotonira C-2 ′ hidroksilnu skupinu dok se kisik dodaje u susjedni fosfat, formirajući fosforanski intermedijer uz dodavanje pozitivno nabijene imidazolijeve skupine na His-119 protona do oksianiona fosfata. U sljedećim koracima, fosforanski međuproizvod se raspada, izbacujući C-5 ′ hidroksilnu grupu sljedeće jedinice, dok ostavlja C-2 ′/C-3 ′ ciklički fosfat. Ovo se zatim hidrolizira u narednim koracima do konačnog proizvoda sa fosfatnom grupom na C-3 ′ i hidroksilnom grupom natrag na C-2 ′. Opisali smo biomimetičke sisteme koji oponašaju ovaj proces, koristeći ili koncentrirani imidazolni pufer sa samom RNK (6 �) ili ciklodekstrine koji nose vezane imidazolne prstenove za cijepanje analoga RNA (11 �). Sada opisujemo cijepanje poli (U) (> 򠌀  jedinica) pomoću dvije klase sintetičkih poliimidazola kao imitacija ribonukleaze A, ponovo tvoreći C-5 ′ hidroksilnu grupu na odlazećoj RNA jedinici kao i kod ribonukleaze A. Također imamo dokaze za vezivanje nekih polimera za RNA prije cijepanja. Cijepanje je poboljšano svojstvima vezanja samog polimera (u usporedbi s onima bez mjesta vezanja), umjesto dodavanjem egzogenih kofaktora metalnih katjona (iako je dodavanje Zn 2+ poboljšalo hidrolizu u našim slučajevima), što ga čini većim atraktivan za daljnju mobilnu primjenu.


Trenutna aplikacija sadrži Seguence List koji je poslan u ASCII formatu putem EFS-Weba i ovime je uključen u cijelosti kao referenca. Navedena ASCII kopija, stvorena 18. januara 2010, nosi naziv 308410US.txt i ima veličinu 462,420 bajtova.

PODRUČJE IZUMA

Pronalazak je u području virusologije. Preciznije, izum je u oblasti koronavirusa.

Pozadina pronalaska

Teški akutni respiratorni sindrom (SARS), svjetska epidemija atipične upale pluća sa ukupnom stopom mortaliteta od oko 3 do 6%, pripisuje se koronavirusu nakon testova uzročnosti prema Kochovim postulatima, uključujući cijepljenje majmuna (R. Munch, Infekcija mikroba 5, 69-74, januar 2003.). Koronavirusi su članovi porodice omotanih virusa koji se razmnožavaju u citoplazmi životinjskih ćelija domaćina (B. N. Fields et al., Fields virology, Lippincott Williams & amp Wilkins, Philadelphia, 4. izdanje, 2001.). Odlikuje ih prisustvo jednolančanog genoma RNS-a sa osjetilima, približno 30 kb dužine, koji ima 5 ′ strukturu kape i 3 ′ poliA trakt. Stoga je genom u biti vrlo velika mRNA. Nakon infekcije odgovarajuće stanice domaćina, 5'-najotvoreniji okvir za čitanje (ORF) virusnog genoma se prevodi u veliki poliprotein koji se cijepa virusno kodiranim proteazama kako bi se oslobodilo nekoliko nestrukturnih proteina, uključujući RNA-ovisnu RNA polimerazu ( Pol) i helikazu ATPase (Hel). Ovi proteini su pak odgovorni za umnožavanje virusnog genoma, kao i za generiranje ugniježđenih transkripata koji se koriste u sintezi virusnih proteina. Mehanizam kojim se stvaraju ove subgenomske mRNA nije u potpunosti razjašnjen, međutim transkripcijske regulacijske sekvence (TRS) na 5 'kraju svakog gena mogu predstavljati signale koji reguliraju diskontinuiranu transkripciju subgenomskih mRNA (sgmRNA). TRS-ovi uključuju djelomično očuvanu sekvencu jezgre (CS) koja je u nekim koronavirusima 5′-CUAAAC-3 ′. Predložena su dva glavna modela za objašnjenje diskontinuirane transkripcije kod koronavirusa i arteriovirusa (MMC Lai, D. Cavanagh, Adv Virus Res. 48, 1 (1997) SG Sawicki, DL Sawicki, Adv. Exp. Med Biol. 440, 215 ( 1998)). Otkriće transkripciono aktivnih, subgenomskih veličina minus lanaca koji sadrže sekvencu antileadera i transkripcijske intermedijere aktivne u sintezi mRNA (DL Sawicki i sur., J. Gen Virol 82, 386 (2001) SG Sawicki, DL Sawicki, J. Virol 64, 1050 (1990) M. Schaad, RSJ Baric, J. Virol. 68, 8169 (1994) PB Sethna et al., Proc. Natl. Acad. Sci. USA 86, 5626 (1989)) daje prednost modelu diskontinuirana transkripcija tokom sinteze minus lanca (SG Sawicki, DL Sawicki, Adv. Exp. Med Biol. 440, 215 (1998)).

Proteini koronavirusne membrane, uključujući glavne proteine ​​S (Spike) i M (membrana), ubacuju se u Golgijev intermedijarni odjeljak endoplazmatskog retikuluma (ERGIC), dok se replicirana RNA pune dužine (+ niti) sastavlja s proteinom N (nukleokapsid). Ovaj RNA-proteinski kompleks tada se povezuje s M proteinom ugrađenim u membrane ER i čestice virusa se formiraju kao pupoljci kompleksa nukleokapsida u ER. Virus zatim migrira kroz Golgijev kompleks i na kraju izlazi iz ćelije, vjerojatno egzocitozom (B. N. Fields i sur., Fields virology, Lippincott Williams & amp Wilkins, Philadelphia, 4. izdanje, 2001.). Mjesto vezivanja virusa za ćeliju domaćina nalazi se unutar S proteina.

Koronavirusi uključuju veliki broj virusa koji inficiraju različite životinjske vrste. Prevladavajuće bolesti povezane s ovim virusima su respiratorne i crijevne infekcije, iako se jetrene i neurološke bolesti javljaju i kod nekih virusa. Koronavirusi su podijeljeni u tri serotipa, Tipovi I, II i III. Filogenetska analiza sekvenci koronavirusa također identificira tri glavne klase ovih virusa, koji odgovaraju svakom od tri serotipa. Koronavirusi tipa II sadrže gen hemaglutinin esteraze (HE) homologan genu virusa influence C. Pretpostavlja se da je prekursor koronavirusa tipa II stekao HE kao rezultat rekombinacijskog događaja unutar dvostruko inficirane ćelije domaćina.

S obzirom na brzo svjetsko širenje SARS -a, koje ima potencijal stvaranja pandemije, uz alarmantne stope morbiditeta i mortaliteta, bilo bi korisno bolje razumjeti ovaj uzročnik koronavirusa na molekularnoj razini kako bi se pružila dijagnostika, cjepiva i terapiju, te za podršku mjerama kontrole javnog zdravlja.

SAŽETAK IZUMA

Općenito, izum daje genomsku sekvencu novog koronavirusa, virusa SARS, i daje nove molekule nukleinske kiseline koji kodiraju nove proteine ​​koji se mogu koristiti, na primjer, za dijagnozu ili terapiju različitih poremećaja povezanih s virusom SARS.

U jednom aspektu, izum pruža u osnovi čistu molekulu nukleinske kiseline virusa SARS ili njen fragment, na primjer, genorničnu RNK ili DNK, cDNK, sintetičku DNK ili molekul mRNA. U nekim realizacijama, molekul nukleinske kiseline uključuje niz koji je u suštini identičan bilo kojoj od sekvenci SEQ ID NO: 1-13, 15-18, 20-30, 90-159, 208, 209. U nekim realizacijama, nukleinska kiselina Molekul uključuje sekvencu iz SEQ ID NO: 1, SEQ ID NO: 2 ili SEQ ID NO: 15 ili fragment ovih sekvenci. U alternativnim ostvarenjima, molekul nukleinske kiseline može uključivati ​​sekvencu koja je u suštini identična SEQ ID NO: 1, SEQ ID NO: 2 ili SEQ ID NO: 15, ili njen fragment. U alternativnim realizacijama, molekula nukleinske kiseline može uključivati ​​s2m motiv (na primjer, s2m sekvenca u suštini identična bilo kojoj od sekvenci SEQ ID NO: 16, 17 i 18), vodeća sekvenca (na primjer, sekvenca bitno identična sekvenci SEQ ID NO: 3), ili transkripcionu regulatornu sekvencu (na primer, sekvencu koja je u suštini identična bilo kojoj od sekvenci SEQ ID NO: 4-13 i 20-30). U alternativnim realizacijama, molekul nukleinske kiseline uključuje niz koji je u suštini identičan bilo kojoj od sekvenci nukleotida 265-13,398 13,398-21,485 21,492-25,259 25,268-26,092 25,689-26,153 26,117-26,347 26,398-27,063 27,074-27,265 27,273-27,641 27,638-27,772 27,779-27,898 27,864-28,118 28,120-29,388 28,130-28,426 28,583-28,795 i 29,590-29,621 SEQ ID NO: 15. U alternativnim realizacijama, molekul nukleinske kiseline može kodirati poliprotein ili polipeptid. U alternativnim realizacijama, pronalazak daje molekul nukleinske kiseline uključujući sekvencu komplementarnu nukleotidnoj sekvenci virusa SARS.

U alternativnom aspektu, izum pruža u osnovi čisti polipeptid SARS virusa ili njegov fragment, na primjer, poliprotein, glikoprotein (na primjer, matriks glikoprotein koji može uključivati ​​sekvencu koja je u biti identična sekvenci SEQ ID NO: 34), transmembranski protein (na primjer, multitransmembranski protein, transmembranski protein tipa I ili transmembranski protein tipa II), protein koji veže RNA ili protein ovojnice virusa. U alternativnim realizacijama, pronalazak daje protein replike 1a, protein replike 1b, glikoprotein sa šiljkom, protein male ovojnice, glikoprotein matrice ili protein nukleokapsida. U alternativnim realizacijama, pronalazak daje molekul nukleinske kiseline koji kodira polipeptid virusa SARS. U alternativnim ostvarenjima, polipeptid virusa SARS uključuje identifikacijsku signalnu sekvencu (na primjer, signalnu sekvencu koja je u biti identična sekvenci SEQ ID NO: 76 ili 85), transmembransku domenu (na primjer, transmembransku domenu koja je u biti identična bilo kojoj od sekvence SEQ ID NO: 77-86), transmembransko sidro, transmembranska spirala, domena koja veže ATP, signal nuklearne lokalizacije, hidrofilna domena (na primjer, hidrofilna domena u biti identična sekvenci SEQ ID NOs: 87), ili sekvencom bogatom lizinom (na primjer, sekvenca bitno identična sekvenci SEQ ID NO: 14). U alternativnim ostvarenjima, polipeptid virusa SARS-a može uključivati ​​sekvencu u suštini identičnu bilo kojoj od sekvenci SEQ ID NO: 14, 33-36, 64-74 i 76-87.

U alternativnim ostvarenjima, izum pruža vektor (na primjer, vektor genske terapije ili vektor kloniranja) koji uključuje molekulu nukleinske kiseline virusa SARS (na primjer, molekul koji uključuje sekvencu u biti identičnu bilo kojoj od sekvenci SEQ ID NO: 1-13, 15-18, 20-30, 90-159, 208, 209), ili ćelije domaćina (na primjer, stanice sisavca, kvasca, bakterije ili ćelije nematode) uključujući vektor.

U alternativnim ostvarenjima, izum pruža molekule nukleinske kiseline sa značajnim identitetom nukleotidne sekvence (na primjer, 30%, 40%, 50%, 60%, 70%, 80%, 90%ili 100%komplementarnosti) sekvenci koja kodira Polipeptid virusa SARS -a ili njegov fragment, na primjer gdje fragment uključuje najmanje šest aminokiselina i gdje se molekula nukleinske kiseline hibridizira pod visokim strogim uvjetima u barem dio molekule nukleinske kiseline virusa SARS.

U alternativnim ostvarenjima, izum pruža molekulu nukleinske kiseline koja ima značajan identitet nukleotidne sekvence (na primjer, 30%, 40%, 50%, 60%, 70%, 80%, 90%ili 100%komplementarnosti) s nukleotidom virusa SARS sekvencu, na primjer gdje molekula nukleinske kiseline uključuje najmanje deset nukleotida, i gdje se molekula nukleinske kiseline hibridizira pod visokim strogim uvjetima s najmanje dijelom molekule nukleinske kiseline virusa SARS.

U alternativnim ostvarenjima, pronalazak daje molekul nukleinske kiseline koji sadrži sekvencu koja je antisense za molekule nukleinske kiseline virusa SARS, ili antitijelo (na primjer, neutralizirajuće antitijelo) koje se specifično veže za polipeptid virusa SARS.

U alternativnim ostvarenjima, izum pruža metodu za otkrivanje epitopa SARS -a, poput viriona ili polipeptida u uzorku, kontaktiranjem uzorka s antitijelom koje specifično veže epitop SARS -a, poput polipeptida virusa, i određivanjem da li je antitijelo specifično se veže za polipeptid. U alternativnim ostvarenjima, izum pruža metodu za otkrivanje genoma, gena ili homologa virusa SARS -a u uzorku kontaktiranjem molekule nukleinske kiseline virusa SARS, na primjer gdje molekula nukleinske kiseline uključuje najmanje deset nukleotida, sa Priprema genomske DNK iz uzorka, u uslovima hibridizacije, obezbeđujući detekciju DNK sekvenci koje imaju identičnost nukleotidne sekvence sa molekulom nukleinske kiseline virusa SARS. U alternativnim realizacijama, izum pruža metodu ciljanja proteina za sekreciju iz ćelije, vezivanjem signalne sekvence iz polipeptida virusa SARS na protein, tako da se protein izlučuje iz ćelije.

U alternativnim aspektima, izum pruža metodu za izazivanje imunološkog odgovora kod životinje, identifikacijom životinje zaražene virusom SARS -a ili rizikom od infekcije virusom SARS -a i davanjem polipeptida virusa SARS -a ili njegovog fragmenta ili njegovog fragmenta ili davanjem SARS -a molekula nukleinske kiseline virusa koja kodira polipeptid SARS virusa ili njegov fragment za životinju. U alternativnim izvedbama, davanje rezultira proizvodnjom antitijela u sisavca ili rezultira stvaranjem citotoksičnih ili pomoćnih T-limfocita u sisavca.

U alternativnim izvedbama, izum pruža komplet za otkrivanje prisutnosti molekule ili polipeptida nukleinske kiseline virusa SARS, gdje komplet uključuje molekulu nukleinske kiseline virusa SARS, ili antitijelo koje specifično veže polipeptid virusa SARS.

U alternativnim aspektima, izum pruža metodu za liječenje ili sprječavanje infekcije virusom SARS -a identifikacijom životinje (npr. Čovjeka) zaražene virusom SARS -a ili rizikom od infekcije, te davanjem molekule ili polipeptida virusa SARS -a, ili davanje spoja koji inhibira patogenost ili replikaciju virusa SARS -a, životinjama. U alternativnim ostvarenjima, izum predviđa upotrebu molekula ili polipeptida nukleinske kiseline virusa SARS za liječenje ili prevenciju infekcije virusom SARS.

U alternativnim aspektima, izum pruža metodu identifikacije spoja za liječenje ili sprječavanje infekcije virusom SARS -a, kontaktiranjem uzorka koji uključuje molekulu nukleinske kiseline virusa SARS -a ili kontaktiranjem polipeptida virusa SARS -a sa spojem, pri čemu se povećava ili smanjuje ekspresija ili aktivnost molekula nukleinske kiseline ili polipeptida identificira spoj za liječenje ili sprječavanje infekcije virusom SARS.

U alternativnim aspektima, izum pruža vakcinu (npr. DNK vakcinu) koja uključuje molekul nukleinske kiseline ili virus polipeptida SARS virusa.

U alternativnim aspektima, izum pruža mikro niz koji uključuje više elemenata, pri čemu svaki element uključuje jednu ili više različitih sekvenci nukleinske kiseline ili aminokiseline, i gdje su sekvence odabrane iz molekule ili polipeptida virusa SARS, ili antitijela koje specifično veže molekulu nukleinske kiseline ili polipeptid virusa SARS.

U alternativnim aspektima, izum pruža zapis koji se može čitati na računaru (npr. Baza podataka) uključujući različite sekvence nukleinske kiseline ili aminokiseline virusa SARS.

"SARS virus" je virus koji navodno pripada porodici koronavirusa i identificiran je kao uzročnik iznenadnog akutnog respiratornog sindroma (SARS). Molekul nukleinske kiseline virusa SARS može uključivati ​​sekvencu u suštini identičnu sekvencama nukleotida koje su ovde opisane ili njihove fragmente. Polipeptid virusa SARS može uključivati ​​sekvencu koja je u suštini identična sekvenci kodiranoj molekulom nukleinske kiseline virusa SARS, ili može uključivati ​​sekvencu u suštini identičnu sekvencama polipeptida koje su ovde opisane, ili njihove fragmente.

Jedinjenje je „bitno čisto“ kada se odvoji od komponenti koje ga prirodno prate. Tipično, spoj je u biti čist kada čini najmanje 60%, općenito 75%ili preko 90%, po težini, ukupnog materijala u uzorku. Tako će, na primjer, polipeptid koji je kemijski sintetiziran ili proizveden rekombinantnom tehnologijom općenito biti značajno oslobođen svojih prirodno povezanih komponenti. Molekula nukleinske kiseline može biti u biti čista ako nije odmah u susjedstvu sa (tj. Kovalentno povezana) kodirajućim sekvencama s kojima je normalno u susjedstvu u prirodnom genomu organizma iz kojeg je izvedena DNK izuma. Molekula nukleinske kiseline može biti i znatno čista kada je izolirana iz organizma u kojem se normalno nalazi. U biti čisti spoj može se dobiti, na primjer, ekstrakcijom iz prirodnog izvora ekspresijom rekombinantne molekule nukleinske kiseline koja kodira polipeptidni spoj ili kemijskom sintezom. Čistoća se može mjeriti bilo kojom odgovarajućom metodom, kao što je hromatografija na koloni, gel elektroforeza, HPLC itd.

"U osnovi identična" sekvenca je aminokiselinska ili nukleotidna sekvenca koja se razlikuje od referentne sekvence samo po jednoj ili više konzervativnih supstitucija, o čemu se ovdje raspravlja, ili po jednoj ili više nekonzervativnih supstitucija, delecija ili umetanja smještenih na pozicijama sekvence koje ne uništavaju biološku funkciju molekula aminokiseline ili nukleinske kiseline. Takav slijed može biti najmanje 10%, 20%, 30%, 40%, 50%, 52,5%, 55%ili 60%ili 75%, ili općenito najmanje 80%, 85%, 90%ili 95 %, ili čak 99% ili 100% identično na nivou aminokiselina ili nukleotida u sekvenci koja se koristi za poređenje koristeći, na primjer, Program za poravnanje (Myers i Miller, CABIOS, 1989, 4: 11-17) ili FASTA . Za polipeptide, dužina poredbenih sekvenci može biti najmanje 4, 5, 10 ili 15 aminokiselina ili najmanje 20, 25 ili 30 aminokiselina. U alternativnim ostvarenjima, dužina poredbenih sekvenci može biti najmanje 35, 40 ili 50 aminokiselina ili preko 60, 80 ili 100 aminokiselina. Za molekule nukleinskih kiselina, dužina poredbenih sekvenci može biti najmanje 15, 20 ili 25 nukleotida ili najmanje 30, 40 ili 50 nukleotida. U alternativnim ostvarenjima, dužina poredbenih sekvenci može biti najmanje 60, 70, 80 ili 90 nukleotida ili preko 100, 200 ili 500 nukleotida. Identitet sekvence može se lako izmjeriti pomoću javno dostupnog softvera za analizu sekvenci (npr. Softverski paket za analizu sekvence Grupe za genetiku, Biotehnološkog centra Univerziteta u Wisconsinu, 1710 University Avenue, Madison, Wis. 53705 ili BLAST softver dostupan u Nacionalnoj biblioteci Medicina ili kako je ovdje opisano). Primjeri korisnog softvera uključuju programe Pile-up i PrettyBox. Takav softver odgovara sličnim sekvencama dodjeljujući stupnjeve homologije različitim zamjenama, brisanjima, umetanjem i drugim izmjenama.

Alternativno, ili dodatno, dvije sekvence nukleinske kiseline mogu biti "bitno identične" ako se hibridiziraju pod visokim strogim uslovima. U nekim izvedbama, uvjeti visoke strogosti su, na primjer, uvjeti koji omogućavaju hibridizaciju koja se može uporediti s hibridizacijom koja se javlja pomoću DNK sonde dužine najmanje 500 nukleotida, u puferu koji sadrži 0,5 M NaHPO4, pH 7,2, 7% SDS, 1 mM EDTA i 1% BSA (frakcija V), na temperaturi od 65 ° C, ili pufer koji sadrži 48% formamida, 4,8 × SSC, 0,2 M Tris-Cl, pH 7,6 , 1 × Denhardtova otopina, 10% dekstran sulfata i 0,1% SDS, na temperaturi od 42 ° C (ovo su tipični uvjeti za sjeverne ili južne hibridizacije visoke strogosti.) Hibridizacije se mogu provoditi u periodu od oko 20 do 30 minuta, ili oko 2 do 6 sati, ili oko 10 do 15 sati, ili preko 24 sata ili više. Hibridizacija visoke strogosti također se oslanja na uspjeh brojnih tehnika koje rutinski izvode molekularni biolozi, kao što su PCR visoke strogosti, DNK sekvenciranje, analiza jednolančanog konformacionog polimorfizma i in situ hibridizacija. Za razliku od sjeverne i južne hibridizacije, ove se tehnike obično izvode s relativno kratkim sondama (npr. Obično oko 16 nukleotida ili duže za PCR ili sekvenciranje i oko 40 nukleotida ili duže za in situ hibridizaciju). Uslovi visoke strogoće koji se koriste u ovim tehnikama dobro su poznati stručnjacima u oblasti molekularne biologije, a primjeri se mogu naći, na primjer, u Ausubel et al., Current Protocols in Molecular Biology, John Wiley & amp Sons, New York, NY, 1998, koji je ovdje uključen kao referenca.

Izrazi "nukleinska kiselina" ili "molekul nukleinske kiseline" obuhvaćaju i RNK (plus i minus lance) i DNK, uključujući cDNA, genomsku DNK i sintetičku (npr. Hemijski sintetiziranu) DNK. Nukleinska kiselina može biti dvolančana ili jednolančana. Tamo gdje je jednolančana, nukleinska kiselina može biti osjetilna ili antisensna. Molekula nukleinske kiseline može biti bilo koji lanac od dva ili više kovalentno vezanih nukleotida, uključujući nukleotide koji se pojavljuju u prirodi ili se ne pojavljuju u prirodi, ili analoge ili derivate nukleotida. Pod “RNA” se misli na niz od dvije ili više kovalentno vezanih, prirodno prisutnih ili modificiranih ribonukleotida. Jedan primjer modificirane RNA uključene u ovaj pojam je fosforotioatna RNA. Pod "DNA" se misli na niz od dvije ili više kovalentno vezanih, prirodno prisutnih ili modificiranih deoksiribonukleotida. Pod "cDNA" se misli na komplementarnu ili kopiranu DNK proizvedenu iz RNA šablona djelovanjem RNA-ovisne DNA polimeraze (reverzna transkriptaza). Prema tome, "kDNK klon" znači dupleksnu DNK sekvencu komplementarnu RNA molekulu od interesa, nošen u vektoru za kloniranje.

"Izolirana nukleinska kiselina" je molekul nukleinske kiseline koji je oslobođen molekula nukleinske kiseline koji ga obično prate u genomu ili koji je slobodan od organizma u kojem se normalno nalazi. Stoga se u nekim slučajevima "izolirani" gen ili molekul nukleinske kiseline misli na gen ili molekul nukleinske kiseline koji nisu okruženi molekulima nukleinske kiseline koji normalno (u prirodi) okružuju gen ili molekulu nukleinske kiseline (kao što je genomska sekvence) i/ili je potpuno ili djelomično pročišćen iz drugih transkribovanih sekvenci (kao u biblioteci cDNA ili RNA). U nekim slučajevima, izolirana molekula nukleinske kiseline namjerava označavati genom organizma poput virusa. Izolovana nukleinska kiselina prema pronalasku može se značajno izolovati s obzirom na složeni ćelijski milje u kojem se prirodno javlja. U nekim slučajevima, izolirani materijal će biti dio sastava (na primjer, sirovi ekstrakt koji sadrži druge tvari), puferskog sistema ili mješavine reagensa. U drugim okolnostima, materijal se može pročistiti do bitne homogenosti, na primjer kako je određeno PAGE -om ili kolonskom kromatografijom, kao što je HPLC. Izraz stoga uključuje, na primjer, genom rekombinantnu nukleinsku kiselinu ugrađenu u vektor, poput autonomno replicirajućeg plazmida ili virusa ili u genomsku DNK prokariota ili eukariota, ili koji postoji kao zasebna molekula (npr. CDNA ili fragment genomske DNA proizveden PCR -om ili restrikcijskom endonukleazom) neovisno o drugim sekvencama. Takođe uključuje rekombinantnu nukleinsku kiselinu koja je dio hibridnog gena koji kodira dodatne polipeptidne sekvence. Po mogućnosti, izolirana nukleinska kiselina sadrži najmanje oko 50, 80 ili 90 posto (na molarnoj osnovi) svih prisutnih makromolekularnih vrsta. Tako izolirani gen ili molekula nukleinske kiseline može uključivati ​​gen ili molekulu nukleinske kiseline koji se sintetiziraju kemijski ili rekombinantnim putem. Rekombinantna DNK sadržana u vektoru uključena je u definiciju "izoliranog" kako se ovdje koristi. Također, izolirani molekuli nukleinske kiseline uključuju molekule rekombinantne DNA u heterolognim stanicama domaćinima, kao i djelomično ili bitno pročišćene molekule DNA u otopini. In vivo i in vitro RNK transkripti DNK molekula ovog izuma takođe su obuhvaćeni „izolovanim“ molekulima nukleinske kiseline. Takve izolirane molekule nukleinske kiseline korisne su u proizvodnji kodiranog polipeptida, kao sonde za izolaciju homolognih sekvenci (npr. Od drugih vrsta), za mapiranje gena (npr. In situ hibridizacijom s kromosomima) ili za detekciju ekspresije nukleoze molekul kiseline u tkivu (npr. ljudsko tkivo, kao što je periferna krv), kao na primjer Northern blot analizom.

Razni geni i sekvence nukleinskih kiselina prema pronalasku mogu biti rekombinantne sekvence. Izraz "rekombinantni" znači da je nešto rekombinirano, tako da kada se izrađuje u odnosu na konstrukciju nukleinske kiseline, izraz se odnosi na molekul koji se sastoji od sekvenci nukleinske kiseline koje su spojene ili proizvedene pomoću molekularno bioloških tehnika. Izraz "rekombinantni" kada se odnosi na protein ili polipeptid odnosi se na molekule proteina ili polipeptida koji se eksprimiraju pomoću rekombinantne konstrukcije nukleinske kiseline stvorene pomoću molekularno bioloških tehnika. Izraz "rekombinantni" kada se odnosi na genetski sastav odnosi se na gamete ili potomstvo s novim kombinacijama alela koje se nisu pojavile u roditeljskim genomima. Rekombinantni konstrukti nukleinske kiseline mogu uključivati ​​nukleotidnu sekvencu koja je vezana za sekvencu nukleinske kiseline na koju se u prirodi ne veže ili na koju se veže na drugom mjestu u prirodi. Pozivanje na konstrukt nukleinske kiseline kao "rekombinantno" stoga ukazuje da je molekulom nukleinske kiseline manipulirano pomoću genetskog inženjeringa, tj. Ljudskom intervencijom. Rekombinantni konstrukti nukleinske kiseline mogu se, na primjer, unijeti u ćeliju domaćina transformacijom. Takvi rekombinantni konstrukti nukleinske kiseline mogu uključivati ​​sekvence izvedene iz iste vrste ćelija domaćina ili iz različitih vrsta ćelija domaćina, koje su izolovane i ponovo uvedene u ćelije vrste domaćina. Sekvence konstrukcije rekombinantne nukleinske kiseline mogu se integrirati u genom ćelije domaćina, bilo kao rezultat izvorne transformacije ćelija domaćina, bilo kao rezultat naknadne rekombinacije i/ili popravka.

Kako se ovdje koristi, "heterologan" u odnosu na nukleinsku kiselinu ili protein je molekul koji je manipuliran ljudskom intervencijom tako da se nalazi na drugom mjestu, a ne na mjestu gdje se prirodno nalazi. Na primjer, sekvenca nukleinske kiseline iz jedne vrste može se unijeti u genom druge vrste, ili se sekvenca nukleinske kiseline iz jednog genomskog lokusa može premjestiti u drugi genomski ili ekstrakromasomski lokus u istoj vrsti. Heterologni protein uključuje, na primjer, protein eksprimiran iz heterologne kodirajuće sekvence ili protein eksprimiran iz rekombinantnog gena u ćeliji koja prirodno ne bi eksprimirala protein.

Pod "antisens", kako se ovdje koristi u odnosu na nukleinske kiseline, misli se na sekvencu nukleinske kiseline koja je komplementarna jednom lancu molekula nukleinske kiseline. U nekim realizacijama, antisens sekvenca je komplementarna kodirajućem lancu gena, po mogućnosti, virusa SARS gena. Poželjna molekula antisens nukleinske kiseline je ona koja je sposobna smanjiti nivo polipeptida kodiranog komplementarnim genom kada su oba eksprimirana u ćeliji. U nekim realizacijama, nivo polipeptida je snižen za najmanje 10%, ili najmanje 25%, ili najmanje 50%, u poređenju sa nivoom polipeptida u ćeliji koja izražava samo gen, a ne komplementarnu molekulu antisens nukleinske kiseline.

"Sonda" ili "primer" je jednolančani molekul DNK ili RNK definisane sekvence koji se može upariti sa drugom molekulom DNK ili RNK koja sadrži komplementarnu sekvencu (cilj). Stabilnost rezultirajućeg hibridnog molekula ovisi o opsegu uparivanja baza do kojeg dolazi, a na njega utječu parametri poput stupnja komplementarnosti između sonde i ciljnog molekula i stupnja strogosti uvjeta hibridizacije. Na stupanj strogosti hibridizacije utječu parametri kao što su temperatura, koncentracija soli i koncentracija organskih molekula, poput formamida, a određuju se metodama koje su poznate stručnjacima. Sonde ili primeri specifični za sekvence ili molekule nukleinskih kiselina virusa SARS mogu se razlikovati po dužini od najmanje 8 nukleotida do preko 500 nukleotida, uključujući bilo koju vrijednost između, ovisno o svrsi za koju se koriste i uvjetima pod kojima se koristi sonda ili prajmer . Na primjer, sonda ili prajmer može imati 8, 10, 15, 20 ili 25 nukleotida po dužini, ili može imati najmanje 30, 40, 50 ili 60 nukleotida po dužini ili možda preko 100, 200, 500 ili Dužina 1000 nukleotida. Sonde ili prajmeri specifični za molekule nukleinske kiseline virusa SARS mogu imati veći od 20-30% identiteta sekvence, ili najmanje 55-75% identiteta sekvence, ili najmanje 75-85% identiteta sekvence, ili najmanje 85-99% identiteta sekvence ili 100% identiteta sekvence sa ovdje opisanim sekvencama nukleinskih kiselina. U različitim izvođenjima pronalaska, sonde imaju sekvence: 5′-ATg AAT TAC CAA gTC AAT ggT TAC-3 ′, SEQ ID NO: 160 5′-gAA gCT ATT CgT CAC gTT Cg-3 ′, SEQ ID NO: 161 5′-CTg TAg AAA ATC CTA gCT ggA g-3 ′, SEQ ID NO: 162 5′-CAT AAC CAg TCg gTA CAg CTA-3 ′, SEQ ID NO: 163 5′-TTA TCA CCC gCgAAg AAg CT- 3 ′, SEQ ID NO: 164 5′-CTC TAg TTg CATGAC AgC CCT C-3 ′, SEQ ID NO: 165 5′-TCg TgC gTg gAT TggCTT TgA TgT-3 ′, SEQ ID NO: 166 5′-ggg TTg ggA CTA TCC TAA gTg TgA-3 ′, SEQ ID NO: 167 5′-TAA CAC ACA AAC ACC ATC ATC A-3 ′, SEQ ID NO: 168 5′-ggT Tgg gAC TAT CCT AAg TgT gA-3 ′ , SEQ ID NO: 169 5′-CCA TCA TCA gAT AgA ATC ATC ATA-3 ′, SEQ ID NO: 170 5′-CCT CTC TTg TTC TTg CTC gCA-3 ′, SEQ ID NO: 171 5′-TAT AgT gAg CCg CCA CAC Atg-3 ′, SEQ ID NO: 172 5′-TAACACACAACICCATCATCA-3 ′, SEQ ID NO: 173 5′-CTAACATGCTTAGGATAATGG-3 ′, SEQ ID NO: 174 5′-GCCTCTCTTGTTCTTGC, NO: 175 5′-CAGGTAAGCGTAAAACTCATC-3 ′, SEQ ID NO: 176 5′-TACACACCTCAGCGTTG-3 ′, SEQ ID NO: 177 5′-CACGAACGTGACGAAT-3 ′, SEQ ID NO: 178 5′-GC CGGAGCTCTGCAGAATTC-3 ', SEQ ID NO: 179 5'-CAGGAAACAGCTATGAC TTGCATCACCACTAGTTGTGCCACCAGGTT-3', SEQ ID NO: 180 5'-TGTAAAACGACGGCCAGTTGATGGGATGGGACTATCCTAAGTGTGA-3 ', SEQ ID NO: 181 5'-GCATAGGCAGTAGTTGCATC-3', SEQ ID NO: 182 , kao i sekvence pojačane specifičnim kombinacijama ovih sondi, mogu se isključiti iz specifične upotrebe prema izumu. Sonde se mogu označiti detektibilno, radioaktivno ili neradioaktivno, metodama koje su poznate stručnjacima. Sonde se mogu koristiti za metode koje uključuju hibridizaciju nukleinskih kiselina, poput sekvenciranja nukleinskih kiselina, amplifikacije nukleinske kiseline polimeraznom lančanom reakcijom, analize jednolančanog konformacionog polimorfizma (SSCP), analize polimorfizma restrikcijskog fragmenta (RFLP), južne hibridizacije, sjeverne hibridizacije, u situ hibridizacija, ispitivanje pomaka elektroforetske mobilnosti (EMSA) i druge metode koje su poznate stručnjacima.

Pod "komplementarnim" podrazumijeva se da dvije molekule nukleinske kiseline, npr. DNK ili RNK, sadrže dovoljan broj nukleotida koji su sposobni formirati parove baza Watson-Crick kako bi proizveli područje dvolančanosti između dvije nukleinske kiseline. Tako se adenin u jednom lancu DNK ili RNK spaja s timinom u suprotnoj komplementarnoj lanci DNK ili s uracilom u suprotnoj komplementarnoj nizu RNK. Podrazumijeva se da svaki nukleotid u molekulu nukleinske kiseline ne mora tvoriti upareni par baza Watson-Crick s nukleotidom u suprotnoj komplementarnoj niti kako bi nastao dupleks.

Pod "vektorom" se misli na molekulu DNK izvedenu, na primjer, iz plazmida, bakteriofaga ili virusa sisavaca ili insekata, ili umjetnog kromosoma, koji se može koristiti za uvođenje polipeptida, na primjer polipeptida virusa SARS -a, u stanicu domaćina pomoću sredstva replikacije ili ekspresije operabilno povezane molekule heterologne nukleinske kiseline. Pod "operativno povezanim" podrazumijeva se da su molekula nukleinske kiseline, kao što je gen i jedna ili više regulatornih sekvenci (npr. Promotori, ribosomalna vezna mjesta, terminatori u prokariotskim promotorima, terminatori, pojačivači u vodećim sekvencama eukariota, itd.) Povezani u na takav način da dozvoli željenu funkciju, npr ekspresiju gena kada su odgovarajući molekuli (npr. proteini aktivatora transkripcije) vezani za regulatorne sekvence.Vektor može sadržavati jedno ili više jedinstvenih restrikcijskih mjesta i može biti sposoban za autonomnu replikaciju u definiranom organizmu domaćinu ili nosaču tako da se klonirana sekvenca može reproducirati. Pod "vektorom ekspresije DNK" podrazumijeva se svaki autonomni element sposoban usmjeriti sintezu rekombinantnog peptida. Takvi vektori ekspresije DNK uključuju bakterijske plazmide i fage te plazmide i viruse sisavaca i insekata. "Shuttle vektor" shvaća se kao vektor koji se može razmnožavati u najmanje dvije različite ćelijske vrste ili organizme, na primjer vektore koji se prvo razmnožavaju ili repliciraju u prokariotima kako bi, na primjer, uslijedila transfekcija u eukariotske ćelije. "Replikon" je jedinica koja je sposobna za autonomnu replikaciju u ćeliji i može uključivati ​​plazmide, kromosome (na primjer, mini-kromosome), kozmide, viruse itd. Replikon može biti vektor.

"Ćelija domaćin" je svaka ćelija, uključujući prokariotsku ili eukariotsku ćeliju, u koju je replikon, poput vektora, uveden na primjer transformacijom, transfekcijom ili infekcijom.

"Otvoreni okvir za čitanje" ili "ORF" je sekvenca nukleinske kiseline koja kodira polipeptid. ORF može uključivati ​​kodirajuću sekvencu koja ima, tj. Sekvencu koja se može transkribovati u mRNA i/ili prevesti u protein kada se kombinuje sa odgovarajućim regulatornim sekvencama. Općenito, kodirajući niz uključuje 5 'startni kodon translacije i 3' zaustavni kodon translacije.

“Lider sekvenca” je relativno kratka nukleotidna sekvenca smještena na 5 ′ kraju molekule RNA koja djeluje kao prajmer za transkripciju.

„Transkripcijska regulatorna sekvenca“ „TRS“ ili „intergena sekvenca“ je nukleotidna sekvenca koja leži uzvodno od otvorenog okvira za čitanje (ORF) i služi kao predložak za ponovnu asocijaciju novonastalog kompleksa polimeraze RNK.

"Mutacija pomaka okvira" uzrokovana je pomakom u otvorenom okviru za čitanje, općenito zbog brisanja ili dodavanja barem jednog nukleotida, tako da se alternativni polipeptid na kraju prevodi.

Pod "prepoznatljivo obilježenim" podrazumijeva se bilo koji način za označavanje i identifikaciju prisutnosti molekula, npr. Oligonukleotidna sonda ili prajmer, gen ili njegov fragment, cDNA molekul, polipeptid ili antitijelo. Metode za obilježavanje molekula koje se mogu detektirati dobro su poznate u tehnici i uključuju, bez ograničenja, radioaktivno označavanje (npr. Izotopom kao što je 32 P ili 35 S) i neradioaktivno označavanje, poput enzimskog označavanja (na primjer, upotrebom peroksidaze od hrena) ili alkalne fosfataze), hemiluminiscentno označavanje, fluorescentno označavanje (na primjer, upotrebom fluoresceina), bioluminiscentno označavanje, otkrivanje antitijela liganda vezanog za sondu ili otkrivanje dvolančane nukleinske kiseline. U ovu definiciju je uključen i molekul koji je uočljivo označen indirektnim putem, na primjer, molekul koji je vezan za prvi dio (kao što je biotin) koji je pak vezan za drugi dio koji se može primijetiti ili ispitivano (poput streptavidina označenog fluoresceinom). Oznake također uključuju digoksigenin, luciferaze i aequorin.

"Peptid", "protein", "poliprotein" ili "polipeptid" je bilo koji lanac od dvije ili više aminokiselina, uključujući prirodne ili neprirodne aminokiseline ili analoge aminokiselina, bez obzira na posttranslacijske modifikacije (npr. glikozilacija ili fosforilacija). "Poliprotein", "polipeptid", "peptid" ili "protein" prema pronalasku može uključivati ​​peptide ili proteine ​​koji imaju abnormalne veze, unakrsne veze i završne kape, ne-peptidilne veze ili alternativne modifikacijske grupe. Takvi modifikovani peptidi su takođe u dometu pronalaska. Izraz "modificirajuća grupa" namjerava obuhvatiti strukture koje su direktno vezane za peptidnu strukturu (npr. Kovalentnom spregom), kao i one koje su neizravno vezane za peptidnu strukturu (npr. Stabilnom nekovalentnom asocijacijom ili kovalentnim spajanjem na dodatne aminokiselinske ostatke, ili mimetike, analoge ili njihove derivate, koji mogu biti bočni u peptidnoj strukturi jezgre). Na primjer, modifikacijska grupa može biti spojena na amino-terminus ili karboksi-kraj peptidne strukture, ili na peptidnu ili peptidomimetičku regiju koja okružuje domenu jezgre. Alternativno, modifikacijska grupa može biti spojena na bočni lanac od najmanje jednog aminokiselinskog ostatka peptidne strukture ili na peptidnu ili peptido-mimetičku regiju koja okružuje domenu jezgre (npr. Preko epsilon amino grupe lizilnog ostatka ( s), preko karboksilne grupe ostataka (a) asparaginske kiseline ili ostatka (a) glutaminske kiseline, preko hidroksi grupe ostataka (a) tirozila, serinskih ostataka ili ostataka treonina ili druga prikladna reaktivna grupa na bočnom lancu aminokiselina). Modifikacijske grupe kovalentno povezane sa peptidnom strukturom mogu se povezati pomoću i metodama dobro poznatim u tehnici za povezivanje hemijskih struktura, uključujući, na primjer, amidne, alkilamino, karbamatne ili uree veze.

"Poliprotein" je polipeptid koji je inicijalno preveden iz genoma plus-lanac RNA virusa, na primjer, SARS virusa. Prema tome, poliprotein nije bio podvrgnut posttranslacijskoj obradi proteolitičkim cijepanjem u njegove prerađene proteinske proizvode, te stoga zadržava svoja mjesta cijepanja. U nekim izvedbama izuma, mjesta cijepanja proteaze poliproteina mogu se modificirati, na primjer, zamjenom aminokiselina, kako bi se dobio poliprotein koji se ne može cijepati u njegove prerađene proteinske proizvode.

Antitijelo se „specifično veže“ ili „selektivno veže“ antigen kada prepozna i veže antigen, ali ne prepoznaje bitno i ne veže druge molekule u uzorku, na primjer sa afinitetom za antigen koji je 10, 100, 1000 ili 10000 puta veći od afiniteta antitijela za drugu referentnu molekulu u uzorku. "Neutralizacijsko antitijelo" je antitijelo koje selektivno ometa bilo koju od bioloških aktivnosti polipeptida ili poliproteina virusa SARS -a, na primjer, replikaciju virusa SARS -a ili infekciju ćelija domaćina. Neutralizirajuće antitijelo može smanjiti sposobnost polipeptida virusa SARS -a da provodi svoju specifičnu biološku aktivnost za oko 50%, ili za oko 70%, ili za oko 90%ili više, ili može potpuno ukinuti sposobnost polipeptida virusa SARS -a da obavlja svoju specifičnu biološku aktivnost. Bilo koji standardni test biološke aktivnosti bilo kojeg polipeptida virusa SARS -a, na primjer, testovi koji određuju nivoe ekspresije, sposobnost inficiranja ćelija domaćina ili sposobnost replikacije DNK, uključujući ovdje opisane testove ili poznate stručnjacima. koristi se za procjenu potencijalno neutralizirajućih antitijela koja su specifična za polipeptide virusa SARS.

"Signalna sekvenca" je sekvenca aminokiselina koja se može identificirati, na primjer po homologiji ili biološkoj aktivnosti, na peptidnu sekvencu s poznatom funkcijom usmjeravanja polipeptida na određenu regiju stanice. Signalna sekvenca ili signalni peptid može biti peptid bilo koje dužine, koji može ciljati polipeptid na određenu regiju ćelije. U nekim izvedbama, signalna sekvenca može usmjeriti polipeptid na staničnu membranu tako da se polipeptid može izlučiti. U alternativnim izvedbama, signalna sekvenca može usmjeriti polipeptid u unutarstanični odjeljak ili organelu, poput Golgijevog aparata, ili na površinu virusa, poput virusa SARS. U alternativnim ostvarenjima, signalna sekvenca može biti u rasponu od oko 13 ili 15 aminokiselina do dužine do oko 60 aminokiselina.

"Transmembranski protein" je amfipatski protein s hidrofobnom regijom ("transmembranski domen") koji se proteže kroz lipidni dvosloj stanične membrane od citoplazme do stanične površine, ili preko virusne ovojnice, razbacane između hidrofilnih regija s obje strane membranu. Broj hidrofobnih regija u amfipatskom proteinu često je proporcionalan broju puta kada proteini prelaze lipidni dvosloj. Dakle, jedan transmembranski protein jednom se proteže preko dvosloja lipida i ima jednu transmembransku domenu, dok se multi-transmembranski protein proteže preko lipidnog dvosloja više puta. Više transmembranski proteini mogu omogućiti ulazak virusa u ćeliju domaćina ili djelovati tako da iniciraju transdukciju signala s površine ćelije u unutrašnjost ćelije, na primjer, konformacijskom promjenom nakon vezanja liganda. "Transmembransko sidro" je transmembransko područje koje održava polipeptid u svom položaju u staničnoj membrani ili ovojnici virusa i općenito je hidrofobno. Transmembransko sidro može općenito biti u strukturi alfa spirale, tj. "Transmembranske spirale". Multi-transmembranski proteini mogu imati više transmembranskih alfa-spirala.

"Signal nuklearne lokalizacije" je aminokiselinska sekvenca koja dozvoljava ulazak polipeptida u jezgru stanice kroz nuklearne pore. Signal nuklearne lokalizacije općenito ima skupinu pozitivno nabijenih ostataka, na primjer, lizina. "Sekvenca bogata lizinom" je sekvenca koja ima najmanje dva susjedna lizinska ostatka ili najmanje tri susjedna lizinska ostatka. U nekim realizacijama, sekvenca bogata lizinom može biti signal nuklearne lokalizacije.

“Domena vezanja ATP-a” je konsenzusna domena koja se nalazi u mnogim proteinima koji vežu ATP ili GTP i tvori fleksibilnu petlju (P-petlja) između alfa-spiralnih i beta nabranih domena lista. Opći konsenzus za domenu vezanja ATP-a može biti (A ili G) -XXXXGK- (S ili T).

“Protein koji veže RNA” je protein koji se može vezati za molekul RNA (vidi, na primjer, “Proteini koji vežu RNA: Novi koncepti u regulaciji gena”, 1. izdanje, ur. K. Sandberg i SE Mulroney, Kluwers Academic Publishers , 2001). Proteini koji vežu RNA mogu sadržavati uobičajene strukturne karakteristike, poput tragova bogatih argininom, na primjer, arginine koji se izmjenjuju s aspartatima, serinima ili glicinima, ili regijama cinkovih prstiju. Proteini koji vežu RNA mogu imati i zajednički domen sekvence ribonukleotida. Vjeruje se da proteini koji vežu RNA imaju različite uloge u moduliranju ekspresije gena nakon transkripcije.

"Imunološki odgovor" uključuje, ali nije ograničen na, jedan ili više sljedećih odgovora kod sisara: indukcija antitijela, B ćelija, T ćelija (uključujući pomoćne T ćelije, supresorske T ćelije, citotoksične T ćelije, γδ T ćelije ) usmjereni specifično na antigen (ove) u sastavu ili vakcini, nakon primjene pripravka ili vakcine. Imunološki odgovor na pripravak ili cjepivo stoga općenito uključuje razvoj ćelijskog i/ili antitijelo posredovanog odgovora na sisavca domaćina na sastav ili vakcinu od interesa. Općenito, imunološki odgovor rezultirat će sprječavanjem ili smanjenjem infekcije virusom SARS -a.

"Imunogeni fragment" polipeptida ili molekula nukleinske kiseline odnosi se na aminokiselinu ili nukleotidnu sekvencu koja izaziva imunološki odgovor. Dakle, imunogeni fragment može uključivati, bez ograničenja, bilo koji dio bilo koje od ovdje opisanih sekvenci SARS -a, ili sekvencu koja mu je u suštini identična, a koja uključuje jedan ili više epitopa (antigenska determinanta, tj. Mjesto koje je prepoznala određena ćelija imunološkog sistema) , poput T ćelije ili B ćelije). "Epitop" može uključivati ​​aminokiseline u prostornoj orijentaciji da nisu susjedne u aminokiselinskoj sekvenci, ali su blizu jedna drugoj zbog trodimenzionalne konformacije polipeptida. Epitop može sadržavati najmanje 3, 5, 8 ili 10 ili više aminokiselina. Imunogeni fragmenti ili epitopi mogu se identificirati korištenjem standardnih metoda poznatih stručnjacima, poput tehnika mapiranja epitopa ili grafikona antigenosti ili hidropatije koristeći, na primjer, program Omiga verzije 1.0 iz Oxford Molecular Group (vidi, na primjer, US Patent 4,708,871). Imunogeni fragmenti ili epitopi se također mogu identificirati pomoću metoda za određivanje trodimenzionalne strukture molekula, poput kristalografije rendgenskih zraka ili nuklearne magnetske rezonancije.

"Uzorak" može biti biopsija tkiva, plodove vode, ćelija, krvi, seruma, plazme, urina, stolice, sputuma, konjunktive ili bilo kojeg drugog uzorka ili bilo kojeg ekstrakta dobijenog od pacijenta (čovjeka ili životinje), test subjekt ili eksperimentalna životinja. "Uzorak" može biti i ćelija ili ćelijska linija stvorena u eksperimentalnim uslovima, i njeni sastojci (kao što su supstanti ćelijske kulture, ćelijske frakcije, zaražene ćelije itd.). Uzorak se može analizirati radi otkrivanja prisutnosti gena virusa SARS -a, genoma, polipeptida, molekula nukleinske kiseline ili viriona, ili radi otkrivanja mutacije u genu virusa SARS -a, nivoa ekspresije gena ili polipeptida virusa SARS -a ili biološke funkcije polipeptida virusa SARS -a, koristeći metode poznate u struci. Na primjer, metode kao što su sekvenciranje, analiza jednolančanog konformacionog polimorfizma (SSCP) ili analiza polimorfizma restrikcijskog fragmenta (RFLP) PCR proizvoda izvedenih iz uzorka mogu se koristiti za otkrivanje mutacije u genu virusa SARS ELISA ili Western blot može se koristiti za mjerenje nivoa polipeptida virusa SARS -a ili afiniteta antitijela, Northern blotting se može koristiti za mjerenje nivoa mRNA SARS -a, ili se PCR može koristiti za mjerenje nivoa molekule nukleinske kiseline virusa SARS.

Ostale karakteristike i prednosti pronalaska bit će vidljive iz sljedećeg opisa crteža i izuma, te iz patentnih zahtjeva.

KRATAK OPIS CRTEŽA

FIGS. 1A-D prikazuje filogenetske analize proteina SARS-a. Neukorijenjeno filogenetsko drveće generirano je grozdom (Thompson, J. D. i sur., Nukleinske kiseline Res 22, 4673-80, 11. novembra 1994.) bootstrap analiza koja koristi 1000 iteracija. Pristup Genbank za proteinske sekvence je sljedeći: SL. 1A: Replika 1A: BoCov (goveđi koronavirus): AAL40396, 229E (humani koronavirus): NP07355, MHV (Mišji virus hepatitisa): NP045298, AIBV (virus ptičjeg infektivnog bronhitisa): CAC39113, TGEV (virus prenosivog gastroenteritisa): NP058423. SL. 1B: Matrični glikoprotein: PHEV (virus svinjskog hemaglutinirajućeg encefalomijelitisa): AAL80035, BoCov (goveđi koronavirus): NP150082, AIBV & amp AIBV2 (virus ptičjeg infektivnog bronhitisa): AAF35863 & amp AAK83027, MHV (virus hepatitisa miša): AAF36439, TGEV (virus prenosivog gastroenteritisa): NP058427, 229E & amp OC43 (humani koronavirus): NP073555 & amp AAA45462, FCV (mačji koronavirus): BAC01160. Sl. 1C: Nukleokapsid: MHV (virus hepatitisa miša): P18446, BoCov (goveđi koronavirus): NP150083, AIBV (virus ptičjeg zaraznog bronhitisa): AAK27162, FCV (mačji koronavirus): CAA74230, PTGV (virus svinjskog prenosivog gastroenteritisa): AAM97563, 229E & amp OC43 (humani koronavirus): NP073556 & amp P33469, PHEV (virus svinjskog hemaglutinirajućeg encefalomijelitisa): AAL80036, TCV (turski koronavirus): AAF23873. Sl. 1D: S (Spike) Protein: BoCov (goveđi koronavirus): AAL40400, MHV (virus hepatitisa miša): P11225, OC43 & amp 229E (humani koronavirus): S44241 & amp AAK32191, PHEV (virus svinjskog hemaglutinirajućeg encefalomijelitisa): AAL80031, PRC respiratorni koronavirus): AAA46905, PEDV (virus epidemije svinjskog proljeva): CAA80971, CCov (pseći koronavirus): S41453, FICV (virus mačjeg infektivnog peritonitisa): BAA06805, AIBV (virus zaraznog bronhitisa ptica): AA034396.

Sl. 2 prikazuje shematski prikaz ORF-a i s2m motiva u genomu virusa SARS-a na 29.736 baza.

FIGS. 3A-P prikazuju nukleotidne sekvence genoma virusa SARS od 29.736 baza (SEQ ID NO: 1 i 2).

Sl. 4 prikazuje poravnanje s2m regija iz virusa zaraznog bronhitisa ptica (AIBV SEQ ID NO: 32) i rinovirusa konja serotipa 2 (ERV-2 SEQ ID NO: 31) s 3 'neprevedenom regijom (UTR SEQ ID NO: 18) SARS virusa (TOR2). Očuvana područja u s2m području označena su zvjezdicama.

Sl. 5 prikazuje aminokiselinsku sekvencu SARS virusa S (Spike) glikoproteina (SEQ ID NO: 33).

Sl. 6 prikazuje aminokiselinsku sekvencu glikoproteina virusa SARS M (matriks) (ostaci 1-220 SEQ ID NO: 34).

Sl. 7 prikazuje aminokiselinsku sekvencu proteina virusa SARS E (male ovojnice) (SEQ ID NO: 35).

Sl. 8 prikazuje aminokiselinsku sekvencu proteina N (nukleokapsidnog) virusa SARS -a (SEQ ID NO: 36).

Sl. 9 prikazuje poravnanje matriksa glikoproteina M iz virusa SARS (Tor2_M ili ORF5 SEQ ID NO: 34) i raznih drugih matriks glikoproteina (SEQ ID NOs: 37-43). Zvjezdice (*) označavaju postotak identiteta proteina matrice SARS-a izračunat prema Align (Myers i Miller, CABIOS (1989) 4: 11-17).

FIGS. 10A-B pokazuju poravnanje nukleokapsidnog proteina N iz virusa SARS (Tor2_N SEQ ID NO: 36) i raznih drugih nukleokapsidnih proteina (SEQ ID NO: 44-52 i SEQ ID NO: 199 iz AIBV-a)2 nukleokapsidni protein [virus ptičjeg infektivnog bronhitisa 2]). Zvjezdice (*) označavaju postotak identiteta za SARS nukleokapsidni protein izračunat od strane Align (Myers i Miller, CABIOS (1989) 4: 11-17).

FIGS. 11A-K pokazuju nukleotidnu sekvencu genoma virusa SARS od 29.751 baze (SEQ ID NO: 15).

Sl. 12 prikazuje shematski prikaz ORF-ova i s2m motiva u genomu virusa SARS-a na 29.751 bazi.

FIGS. 13A-D prikazuju filogenetske analize proteina SARS-a. Neukorijenjena filogenetska stabla generirana su clustalw 1.74 (JD Thompson, DG Higgins, TJ Gibson, Nucleic Acids Res 22, 4673-80 (11. studenog 1994.) koristeći matricu za usporedbu BLOSUM-a i bootstrap analizu od 1000 iteracija. Brojevi ukazuju na replike početne stranice koji podržavaju svaki čvor. Filogenetsko drveće nacrtano je programom Phylip Drawtree 3.6a3 (Felsenstein, J. 1993. PHYLIP (Paket zaključaka o filogeniji) verzija 3.5c. Distribuirao autor. Odsjek za genetiku, Univerzitet Washington, Seattle). Dužine grana označavaju broj supstitucija po ostatku Pristup Genbank za proteinske sekvence: O: Replikaza 1O: BoCoV (goveđi koronavirus): AAL40396, HCoV-229E (humani koronavirus): NP07355, MHV (Mišji virus hepatitisa): NP045298, IBV (virus ptičjeg infektivnog bronhitisa): CAC39113, TGEV (virus prenosivog gastroenteritisa): NP058423. B: Membranski glikoprotein: PHEV (virus svinjskog hemaglutinirajućeg encefalomijelitisa): AAL80035, BoCoV (goveđi koronavirus): NP150082, IBV i amp IBV2 (virus ptičjeg infektivnog bronhitisa): AAF35863 & amp AAK83027, MHV (virus hepatitisa miša): AAF36439, TGEV (virus prenosivog gastroenteritisa): NP058427, HCoV-229E & amp HCoV-OC43 (humani koronavirus): NP073555 & amp AAA45462, FCoV (mačji koronavirus): BAC01160. C: Nukleokapsid: MHV (virus hepatitisa miša): P18446, BoCoV (goveđi koronavirus): NP150083, IBV 1 & amp 2 (virus zaraznog bronhitisa ptica): AAK27162 & amp NP040838, FCoV (mačji koronavirus): CAA74230, PTGV (virus svinjskog prijenosnog gastroenteritisa): AAM97563, HCoV-229E i amp HCoV-OC43 (humani koronavirus): NP073556 & amp P33469, PHEV (virus svinjskog hemaglutinirajućeg encefalomijelitisa): AAL80036, TCV (turski koronavirus): AAF23873. D: S (Spike) Proteini: BoCoV (goveđi koronavirus): AAL40400, MHV (virus hepatitisa miša): P11225, HCoV-OC43 & amp HCoV-229E (humani koronavirus): S44241 & amp AAK32191, PHEV (virus svinjskog hemaglutinirajućeg encefalomijelitisa31): , PRCOV (Svinjski respiratorni koronavirus): AAA46905, PEDV (virus epidemije svinjskog proljeva): CAA80971, CCoV (pseći koronavirus): S41453, FIPV (virus mačjeg zaraznog peritonitisa): BAA06805, IBV (virus ptičjeg infektivnog bronhitisa): AAO34396.

FIGS. 14A-F pokazuju poravnanje spiko glikoproteina S iz virusa SARS (Tor2_S SEQ ID NO: 33) i raznih drugih spiko glikoproteina (SEQ ID NOs: 53-62). Zvezdice (*) označavaju procentualni identitet proteina SARS šiljaka izračunatog prema Align (Myers i Miller, CABIOS (1989) 4: 11-17).

Sl. 15 prikazuje usklađenost između virusa SARS virusa male ovojnice E (TOR2_E SEQ ID NO: 35) i proteina ovojnice (proteina 4) (proteina X1) (ORF 3) iz korona virusa prenosivog svinjskog gastroenteritisa (soj Purdue). Pristupni broj Swissprot P09048 (PGV SEQ ID NO: 63), prema izračunu FASTA -e (svjetska mreža na ebi „tačka“ ac „tačka“ uk „kosa crta“ fasta33).

FIGS. 16A-B pokazuju aminokiselinsku sekvencu proteina replike 1A virusa SARS (SEQ ID NO: 64).

Sl. 17 prikazuje aminokiselinsku sekvencu proteina replike 1B virusa SARS (SEQ ID NO: 65).

Sl. 18 prikazuje aminokiselinsku sekvencu ORF3 virusa SARS (SEQ ID NO: 66).

Sl. 19 prikazuje aminokiselinsku sekvencu ORF4 virusa SARS (SEQ ID NO: 67).

Sl. 20 prikazuje aminokiselinsku sekvencu (SEQ ID NO: 68) ORF6 (nukleotidi 27059-27247 sekvence genoma sa 29.736 baza) ili ORF 7 (nukleotidi 27.074-27.265 sekvence genoma 29.751 baze) SARS virusa.

Sl. 21 prikazuje aminokiselinsku sekvencu (SEQ ID NO: 69) ORF7 (nukleotidi 27258-27623 iz sekvence genoma sa 29.736 baza) ili ORF 8 (nukleotidi 27.273-27.641 iz sekvence genoma 29.751 baze), virusa SARS.

Sl. 22 prikazuje aminokiselinsku sekvencu (SEQ ID NO: 70) ORF8 (nukleotidi 27623-27754 sekvence genoma sa 29,736 baza) ili ORF9 8 (nukleotidi 27,638-27,772 sekvence genoma 29,751 baze) SARS virusa.

Sl. 23 prikazuje aminokiselinsku sekvencu (SEQ ID NO: 71) ORF9 (nukleotidi 27764-27880 sekvence genoma sa 29.736 baza) ili ORF10 (nukleotidi 27.779-27.898 sekvence genoma 29.751 baze) SARS virusa.

Sl. 24 prikazuje aminokiselinsku sekvencu (SEQ ID NO: 72) ORF10 (nukleotidi 27849-28100 sekvence genoma sa 29.736 baza) ili ORF11 (nukleotidi 27.864-28118 sekvence genoma 29.751 baze) SARS virusa.

Sl. 25 prikazuje aminokiselinsku sekvencu ORF13 virusa SARS (SEQ ID NO: 73).

Sl. 26 prikazuje aminokiselinsku sekvencu ORF14 virusa SARS (SEQ ID NO: 74).

Sl. 27 prikazuje poravnanje izlučene regije SARS virusa ORF 10 (SEQ ID NO: 201) sekvence genoma (sars) od 29.751 baze sa konotoksinom iz Conus ventricosus (konotoksin) (SEQ ID NO: 200). Identitet sekvence označen je zvjezdicama, a homologija sekvence tačkama.

DETALJAN OPIS IZUMA

Općenito, izum pruža molekule nukleinskih kiselina, polipeptide i druge reagense izvedene iz virusa SARS -a, kao i metode korištenja takvih molekula nukleinske kiseline, polipeptida i drugih reagensa.

Sekvenca genoma (SLIKE 3A-P, 11A-K, SEQ ID NO: 1, 2 i 15) otkrivaju da je SARS koronavirus samo umjereno povezan s drugim poznatim koronavirusima, uključujući dva humana koronavirusa, OC43 i 229E. Dakle, SARS virus je dosad nepoznat virus. 5 'kraj genoma SARS-a sadrži 5 ′ lidersku sekvencu (Tabela 1 SEQ ID NO: 3) sa sličnošću sekvence sa visoko očuvanom jezgrom koronavirusa, 5′-CUAAAC-3 (SEQ ID NO: 75 Sawicki, SG , et al., Adv Exp Med Biol 440, 215-9, 1998 Lai, M. M. i D. Cavanagh, Adv Virus Res 48, 1-100, 1997.). Transkripcijske regulatorne sekvence (TRS) identificirane su uzvodno od svih otvorenih okvira za čitanje (ORF) (Tabele 1 i 2 SEQ ID NO: 3-13 i 20-30). ORF9 i ORF10 genoma SARS-a na 29.736 baza (ORF 10 i ORF 11 iz genoma na bazi 29.751 baze) preklapaju se za 12 aminokiselina i imaju usklađenost sa konsenzusom TRS-a u neposrednoj blizini odgovarajućih inicirajućih metionin kodona.

3 ′ UTR sekvenca (SEQ ID NO: 18) virusa SARS sadrži s2m regiju koja ima sekvencu ACATTTTCATCGAGGCCACGCGGAGTACGAT CGAGGGTACAGTGAAT SEQ ID NO: 16) koja uključuje konzervirana, diskontinuirana 32 osnovna para s2m motiva. Očuvana 32 motiva osnovnih parova univerzalna su značajka astrovirusa koja je također identificirana u koronavirusu ptica (AIBV) i rinovirusu konja ERV-2. Ovaj motiv identifikovali su Jonassen C. M. et al. (J Gen Virol 1998. april 79. (Pt 4): 715-8) kao GCCGNGGCCACGC (G/C) GAGTA (C/G) GANCGAGGGTACAG (G/C) (SEQ ID NO: 19), gdje N općenito nije dio konzervirani motiv, a može biti bilo koji nukleotid. Regija koja odgovara 32 motiva osnovnog para u SARS virusu uključuje niz: CGAGGCCACGCGGAGTACGATCGAGGGTACAG (SEQ ID NO: 17) i obuhvaća položaje 29590-29621 od 29,751 baznog genoma. Sl. 4 prikazuje poravnanje s2m regija iz virusa zaraznog bronhitisa ptica (AIBV SEQ ID NO: 32) i rinovirusa konja serotipa 2 (ERV-2 SEQ ID NO: 31), kako je definirano u Jonassen C. M. et al. (J Gen Virol 1998. aprila 79. (Pt 4): 715-8), sa cijelom 3 'neprevedenom regijom (UTR) virusa SARS (TOR2) (SEQ ID NO: 18).

Kodirajući potencijali genoma sa 29,736 baza i 29,751 baza prikazani su na Sl. 2, odnosno 12. Otvoreni okviri za čitanje (ORF) uključuju prevodilačke proizvode Replikaze 1a i 1b, glikoprotein Spike, mali protein ovojnice, membranu i protein nukleokapsid. Izgradnja neokorjenjenih filogenetskih stabala korištenjem ovog skupa poznatih proteina predstavnika tri poznate koronavirusne grupe otkriva da se proteini kodirani virusom SARS-a ne mogu grupisati bliže bilo kojoj poznatoj grupi nego sa bilo kojom drugom (SLIKE 1A-D i 13A-D). Osim toga, analizirano je devet novih ORF -ova.

Replikaza 1a ORF locirana na nukleotidima 250-13395 genoma sa 29,736 baza, i nukleotidi 265-13,398 iz genoma sa 29,751 bazom, i replika 1b ORF koja se nalazi na nukleotidima 13395-21467 iz genoma sa 29,736 baza, i nukleotidi 13,398- 21.485 genoma od 29.751 baze, zauzima 21.2 kb genoma virusa SARS (SLIKE 2 i 12). Ovi geni kodiraju brojne proteine ​​koji se proizvode proteolitičkim cijepanjem velikog poliproteina (Ziebuhr, J. i sur., J Gen Virol 81, 853-79, april 2000.). Mutacija pomaka okvira prekida područje kodiranja proteina, odvajajući 1a i 1b otvorene okvire za čitanje. Proteini kodirani replikazom 1a i 1b ORF prikazani su na Sl. 16A-B i 17, SEQ ID NO: 64 i 65).

Spike glikoprotein (S) (gen glikoproteina E2 na slikama 2 i 12 nukleotida 21477 do 25241 od 29,736-baznog genoma, a nukleotidi 21,492 do 25,259 genoma od 29,751 baze) kodira prekursor glikoproteina površine od 1,255 aminokiselina u dužine (SLIKA 5 SEQ ID NO: 33), koja može biti značajna u virulenciji virusa SARS. Mutacije u ovom genu povezane su s promijenjenom patogenezom i virulencijom u drugim koronavirusima (B. N. Fields et al., Fields virology (Lippincott Williams & amp Wilkins, Philadelphia, ed. 4., 2001.). U drugim koronavirusima, zreli protein šiljaka umetnut je u omotač virusa, a većina proteina izložena je na površini čestica. Tri molekule proteina Spike tvore karakteristične peplomere ili strukture slične koroni ove porodice virusa. Analiza spiko glikoproteina sa SignalP (Nielson, H. et al., Prot Engineer. 10: 1-6 (1997.) označava signalni peptid (MFIFLLFLTLTSG SEQ ID NO: 76) (vjerovatnoća 0.996) sa cijepanjem između ostataka 13 i 14. TMHMM (Sonnhammer, E. L. et al., Proc Int Conf Intell Syst Mol Biol 6, 175-82 (1998)) označava transmembransku domenu blizu kraja C-terminala (WYVWLGFIAGLIAIVMVTILLCC SEQ ID NO: 183). Zajedno ovi podaci ukazuju na membranski protein tipa I s N-završetkom i većinu proteina (ostaci 14-1195) na vanjskoj strani stanične površine ili čestice virusa, koji mogu biti odgovorni za vezivanje za stanični receptor. Spike glikoprotein SARS virusa ima ograničen identitet sekvence u odnosu na druge, poznate Spike glikoproteine ​​(SLIKE 14A-F).

ORF 3 (SLIKE 2 i 12 nukleotida 25253-26074 od 29,736-baznog genoma i nukleotidi 25,268-26,092 od 29,751-baznog genoma) kodira protein od 274 aminokiseline (SLIKA 18 SEQ ID NO: 66) kojem nedostaje značajno sličnosti sa bilo kojim poznatim proteinom kada se analizira sa BLAST -om (Altschul, SF et al., Nukleinske kiseline Res 25, 3389-402, 1. septembra 1997), FASTA (Pearson, W. R. i D. J. Lipman, Proc Natl Acad Sci USA 85, 2444-8, april 1988.) ili PFAM (Bateman, A. et al., Nukleinske kiseline Res 30, 276-80, 1. januara 2002.). Analiza N-terminalnih 70 aminokiselina sa SignalP ukazuje na postojanje signalnog peptida (MDLFMRFFTLRSITAQ SEQ ID NO: 184) i mjesta cijepanja (vjerovatnoća 0.540). Oba TMpreda (Hofinan, K. i W. Stoffel, Biol. Chem. Hoope-Seyler 374, 166 (1993) i TMHMM ukazuju na tri trans-membranske regije koje se protežu približno na ostatke 34-56 (TIPLQASLPFGWLVIGVAFLAVF, SEQ ID NO: 77), 77-99 (FQFICNLLLLFVTIYSHLLLVAA, SEQ ID NO: 78) i 103-1RIQYLYQ, AQLYQYQYQ, AQDYLYQYQ, AQDYLYQ, AQDYLYQ, AQDYLYQ, AQDYLYQ, AQDYLYQ, AQDYLYQ, AQDYLYQ, AQDYLYQ, AQDYLYQ, AQM, ALQYYLY, AQM, ALQYYLY, AQDYLY, AQDYLYL, AQDYLYL, AQM, FLYLY, AQMY, AQMY, AQD, AQM, AQN, QI SEQ ID NO: 79). I TMpred i TMHMM ukazuju na to da se C-terminus i veliki domen od 149 aminokiselina nalaze unutar virusne ili stanične membrane. C-terminal (unutrašnjost) regija proteina, što odgovara oko aminokiselina 124-274 (MRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGI STPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENAT FFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL SEQ ID NO: 185) mogu kodiraju protein domena sa ATP-vezujući svojstva (PD037277).

ORF 4 (SLIKA 12 nukleotida 25,689-26,153 genoma od 29 751 baze) kodira predviđeni protein od 154 aminokiseline (slika 19 SEQ ID NO: 67). Ovaj ORF se u potpunosti preklapa sa ORF 3 i E proteinom. ORF4 se može eksprimirati iz ORF mRNA koristeći unutrašnje mjesto ulaska ribosoma. BLAST analize nisu uspjele identificirati odgovarajuće sekvence. Analiza sa TMPred predviđa jednu transmembransku spiralu, aminokiseline 1-20 MMPTTLFAGTHITMTTVYHI, SEQ ID NO: 186.

Protein male ovojnice E (SLIKE 2 i 12 nukleotida 26102-26329 od 29,736-baznog genoma i nukleotida 26,117-26,347, ORF 5, od 29,751-genoma) kodira protein od 76 aminokiselina (SLIKA 7 SEQ ID NO : 35). Usporedbe BLAST -a i FASTA -e ukazuju na to da je protein, iako nov, homologan proteinima s više ovojnica (alternativno poznatim kao proteini male membrane) iz nekoliko koronavirusa. Poravnanje proteina E virusa SARS -a sa proteinom ovojnice korona virusa prenosivog gastroenteritisa svinja pokazuje približno 28% identičnosti sekvence između dva proteina zbog preklapanja od 61 aminokiseline, prema FASTA -i (slika 15). PFAM analiza proteina pokazuje da je protein male ovojnice E član porodice proteina NS3_EnvE. InterProScan (R. Apweiler i dr., Nukleinske kiseline Res 29, 37-40, 1. januara 2001. Zdobnov, E. M. i R. Apweiler, Bioinformatika 17, 847-8, rujan, 2001.) analiza pokazuje da je protein sastavni dio ovojnice virusa, a njegovi homolozi se nalaze u drugim virusima, uključujući virus gastroenteritisa i virus hepatitisa u miša. SignalP analiza ukazuje na prisustvo transmembranskog sidra (vjerovatnoća 0,939). TMpred analiza ukazuje na slično transmembransko sidro na pozicijama 17-34 (VLLFLAFVVFLLVTLAIL, SEQ ID NO: 80), što je u skladu s poznatom povezanošću homolognih proteina s ovojnicom virusa. TMHMM označava membranski protein tipa II s većinom od 46 ostataka C terminus hidrofilne domene (TALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV SEQ ID NO: 187) koji se nalazi na površini virusne čestice. E protein može biti važan za replikaciju virusa.

Matriks glikoprotein M (SLIKE 2 i 12 nukleotida 26383-27045 od 29,736-baznog genoma i nukleotidi 26,398-27,063, ORF 6, od 29,751-genoma) kodira protein od 221 aminokiseline (SLIKA 6 SEQ ID NO: 34). BLAST i FASTA analiza proteina, iako nova, otkriva homologije s glikoproteinima koronavirusnog matriksa (slika 9). Povezivanje spiko glikoproteina (S) sa matriks glikoproteinom (M) može biti bitan korak u stvaranju omotača virusa i u akumulaciji oba proteina na mjestu sastavljanja virusa. Analiza aminokiselinske sekvence sa SignalP ukazuje na signalnu sekvencu (vjerovatnoća 0,932), koja se nalazi na otprilike ostacima 1-39 (MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYS SEQ ID NO: 188) za koju je malo vjerojatno da će se rascijepiti. I TMHMM i TMpred analiza ukazuju na prisutnost tri trans-membranske spirale, smještene na otprilike ostacima 15-37 (LLEQWNLVIGFLFLAWIMLLQFA SEQ ID NO: 81), 50-72 (LVFLWLLWPVTLACFVLAAVYRI SEQ ID NO: 82) i 77-99SGGFIWGAM GIGIAVIM NO: 83), sa hidrofilnom domenom od 121 aminokiseline na unutrašnjosti čestice virusa, gdje može stupiti u interakciju s nukleokapsidom. Hidrofilna domena može se kretati od približno aminokiselina PLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLS YYKLGASQRVGTDSGFAAYNRYNIGLYKLNTDHAGSNDNIALLVQ (SEQ ID NO: 78 do PF 78 u bazi podataka PFAM koja nosi ovu domenu, što ukazuje na glikoprotein matrice koronavirusa.

ORF6 (SLIKA 2 nukleotida 27059-27247 sekvence genoma sa 29 736 baza) ili ORF 7 (slika 12 nukleotida 27,074-27,265 sekvence genoma baze 29,751) kodira protein od 63 aminokiseline (slika 20 SEQ ID NO : 68). TMpred analiza ukazuje na trans-membransku spiralu koja se nalazi između ostataka 3 ili 4 i 22 (HLVDFQVTIAEILIIIMRTF SEQ ID NO: 84), a N-kraj se nalazi izvan virusne čestice.

Slično, gen koji kodira ORF7 (slika 2 nukleotida 27258-27623 sekvence genoma od 29,736 baza) ili ORF 8 (slika 12 nukleotida 27,273-27,641 sekvence genoma od 29 751 baze), kodira protein od 122 aminokiseline ( SLIKA 21 SEQ ID NO: 69), nema značajnih BLAST ili FASTA podudaranja sa poznatim proteinima. Analiza ove sekvence sa SignalP ukazuje na rascjepkanu signalnu sekvencu (MKIILFLTLIVFTSC SEQ ID NO: 85) (vjerojatnost 0,995), pri čemu se mjesto cijepanja nalazi između ostataka 15 i 16. TMpred i TMHMM analiza također ukazuje na trans-membransku spiralu koja se nalazi približno na ostacima 99-117 (SPLFLIVAALVFLILCFTI SEQ ID NO: 86). Zajedno, ovi podaci ukazuju da je ovaj protein membranski protein tipa I s glavnom hidrofilnom domenom proteina (ostaci 16-98 ili na površini stanične membrane ili čestice virusa, ovisno o membranskoj lokalizaciji proteina.

ORF8 (slika 2 nukleotida 27623-27754 sekvence genoma od 29 736 baza) ili ORF9 (slika 12 nukleotida 27,638-27,772 sekvence genoma baze 29,751) kodira protein od 44 aminokiseline (slika 22 SEQ ID NO : 70). FASTA analiza ove sekvence otkrila je neke slabe sličnosti (37% identiteta pri preklapanju od 35 aminokiselina) sa pristupanjem Swiss-Prot Q9M883, označeno kao navodna sterol-C5 desaturaza. Slično slaba hipotetička Clostridium perfringens protein (pristup Swiss-Prot CPE2366) je takođe otkriven. TMpred je naznačio jednu jaku trans-membransku spiralu FYLCFLAFLLFLVLIMLIIFWFS, SEQ ID NO: 190, s malo prednosti za alternativne modele u kojima se N-kraj nalazio unutar ili izvan čestice.

Slično, ORF9 (slika 2 nukleotida 27764-27880 sekvence genoma sa 29,736 baza) ili ORF10 (slika 12 nukleotida 27,779-27,898 sekvence genoma baze 29,751) koji kodira protein od 39 aminokiselina (slika 23 SEQ ID NO : 71), nije pokazao značajne podudarnosti u pretragama BLAST-a i FASTA-e, ali kodira trans-membransku spiralu LLIVLTCISLCSCICTVVQ (SEQ ID NO: 191) od TMPred-a, s N-terminusom koji se nalazi unutar virusne čestice. Regija neposredno uzvodno od ovog proteina pokazuje snažno podudaranje sa TRS konsenzusom (Tabela 2), što ukazuje da transkript započinje sa ove lokacije. Veliki broj ostataka cisteina (6) može dovesti do unakrsnog povezivanja aminokiselina. Aminokiseline ICTVVQRCASNKPHVLEDPCKVQH (SEQ ID NO: 192) ovog proteina se mogu izlučivati. Izlučene aminokiseline pokazuju homologiju sa proteinima toksina, na primjer, sa konotoksinom Conus ventricosus (SLIKA 27). Antigeni peptidi iz hidrofilne (izlučene) regije, na primjer, CICTVVQRCASNKPHVLEDPCK (SEQ ID NO: 193), korišteni su za stvaranje monoklonskih antitijela standardnim tehnikama. Nadalje, C terminalne aminokiseline tvore sekvencu koja dijeli homologiju sa mjestima farnezilacije (CKQH), koje općenito zahtijevaju da C terminalna lokacija bude funkcionalna. Ovaj protein može djelovati kao faktor virulencije i/ili može olakšati prijenos na ljude.

ORF10 (SLIKA 2 nukleotida 27849-28100 sekvence genoma sa 29,736 baza) ili ORF11 (slika 12 nukleotida 27,864-28118 sekvence genoma baze 29,751) koji kodira protein od 84 aminokiseline (slika 24 SEQ ID NO: 72) pokazali su samo vrlo kratke (9-10 ostataka) podudarnosti s predjelom humanog koronavirusnog E2 glikoproteinskog prekursora (počevši od ostatka 801). Analizom SignalP -a i TMHMM -a predviđa se topljivi protein. Takođe je pronađeno usklađivanje sa TRS konsenzusnom sekvencom (Tabela 2).

Protein (422 aminokiseline, slika 8 SEQ ID NO: 36) kodiran genom nukleokapsida (slika 2 nukleotida 28105-29370 iz 29,736-baze sekvence genoma, slika 12, nukleotidi 28,120-29,388 sekvence genoma od 29 751 baze) ) dobro se poravnava s nukleokapsidnim proteinima iz drugih reprezentativnih koronavirusa (SLI. 10A-B), iako je kratka regija bogata lizinom (KTFPPTEPKKDKKKKTDEAQ SEQ ID NO: 14) jedinstvena za SARS. Ovo područje sugerira signal nuklearne lokalizacije Budući da se neki koronavirusi mogu replicirati u enukleiranim stanicama, nukleokapsidni protein virusa SARS mogao je razviti novu nuklearnu funkciju, koja može odigrati ulogu u patogenezi. Osim toga, osnovna priroda ovog peptida sugerira da može pomoći u vezanju RNA. SARS nukleokapsidni protein također je dobar kandidat za dijagnostičke testove.

ORF13 (SLIKA 12 nukleotida 28,130-28,426 sekvence genoma sa 29 751 bazom) kodira novi protein od 98 aminokiselina (slika 25 SEQ ID NO: 73). ORF 14 (SLIKA 12 nukleotida 28,583-28,795 sekvence genoma sa 29 751 bazom) kodira novi protein od 70 aminokiselina (slika 26 SEQ ID NO: 74). TMPred predviđa jednu transmembransku spiralu VVAVIQEIQLLAAVGEILLLEW (SEQ ID NO: 194).

Različite karakteristike genoma virusa SARS sažete su u Tablici 3. Dok se Tablica 3 odnosi na sekvencu genoma od 29.751 baze, značajke su primjenjive i na sekvencu genoma s 29.736 baza (SEQ ID NO: 1 i 2).

U virusu SARS mogu postojati različiti polimorfizmi. U sekvencama genoma na bazi baze SARS 29,736 (SEQ ID NO: 1 ili 2), na primjer, nukleotidi 7904, 16607, 19168, 24857 ili 26842 mogu biti C ili T ili nukleotidi 19049, 23205 ili 25283 mogu biti G ili A , a u sekvenci genoma bazirane na SARS-u 29.751 (SEQ ID NO: 15), na primjer, nukleotidi 7919, 16622, 19183, 24872 ili 26857 mogu biti C ili T ili nukleotidi 19064, 23220 ili 25298 mogu biti G ili A U nekim izvedbama, promjene nukleotida mogu rezultirati promjenom kodirane aminokiseline ili konzervativnom ili nekonzervativnom promjenom kodirane aminokiseline. U nekim izvedbama, promjena nukleotida, kako je ovdje opisano, na poziciji 7904 ili 7919, može rezultirati zamjenom aminokiselina A do V, u kodirajućoj regiji Replikaze 1A proteina promjena na poziciji 19168 ili 19183 može rezultirati od V do A supstitucija aminokiselina, u kodirajućoj regiji Replicase IB proteina promjena na poziciji 23205 ili 23220 može rezultirati zamjenom aminokiselina A do S (nekonzervativna promjena), što utječe na kodirajuću regiju glikoproteina Spike-a može doći do promjene na položaju 25283 ili 25298 u supstituciji aminokiselina R u G (nekonzervativna promjena), koja utječe na ORF3 ili promjena na poziciji 26842 ili 26857 može rezultirati supstitucijom S do P aminokiseline (nekonzervativna promjena), utječući na područje kodiranja proteina nukleokapsida, u sekvence SARS 29,736 baza (SEQ ID NO: 1 ili 2) i 29,751 baza genoma (SEQ ID NO: 15), respektivno. U različitim izvedbama, nukleotidna ili aminokiselinska sekvenca koja uključuje određeni polimorfizam može biti odabrana, na primjer, za upotrebu u postupcima prema izumu, ili može biti isključena, na primjer, iz određene upotrebe prema izumu.

U nastavku su opisana različita alternativna izvođenja pronalaska. Ove izvedbe uključuju, bez ograničenja, identifikaciju i upotrebu nukleinskih kiselina i aminokiselinskih sekvenci virusa SARS za dijagnostičku ili terapijsku upotrebu.

Dijagnoza poremećaja povezanih s virusom SARS

Poremećaj povezan sa virusom SARS je svaki poremećaj koji je posredovao virus SARS, ili molekula nukleinske kiseline ili polipeptid izveden iz virusa SARS. U skladu s tim, molekule nukleinske kiseline i polipeptidi virusa SARS mogu se koristiti za dijagnosticiranje i identifikaciju poremećaja povezanih sa virusom SARS kod sisavaca, na primjer, čovjeka ili domaće, farme, divlje ili eksperimentalne životinje. U nekim izvedbama, molekuli nukleinske kiseline i polipeptidi virusa SARS mogu se koristiti za skrining takvih životinja, na primjer, cibetkih mačaka, na prisutnost virusa SARS. Poremećaj povezan sa virusom SARS može biti jetreni, crijevni, respiratorni ili neurološki poremećaj, a može biti popraćen jednim ili više simptoma ili indikacija uključujući, ali ne ograničavajući se na, groznicu, kašalj, otežano disanje, glavobolju, nizak kisik u krvi koncentracija, oštećenje jetre ili smanjeni broj limfocita. U skladu s tim, uzorci za dijagnozu mogu se uzeti iz stanica, krvi, seruma, plazme, urina, stolice, konjunktive, sputuma, brisa iz ždrijela ili orofarinksa, dušničkih aspirata, ispiranja bronhalveolara, pleuralne tekućine, plodne vode ili bilo kojeg drugog uzorka ili bilo kojeg ekstrakta ili biopsijom tkiva, na primjer pluća ili većih organa, dobivenih od pacijenta (čovjeka ili životinje), ispitanika ili eksperimentalne životinje.

Poremećaj povezan sa virusom SARS može se dijagnosticirati amplifikacijom molekule nukleinske kiseline SARS-a iz uzorka. Sonde ili prajmeri za upotrebu u amplifikaciji mogu se pripremiti standardnim tehnikama. U nekim izvedbama, sonde ili početnice su odabrane iz regija genoma virusa SARS -a kako je ovdje opisano koje pokazuju homologiju ili identitet ograničene sekvence (npr. Manje od 10%, 20%, 30%, 40%, 50%, 60%, 70 %, 80%, 90%ili 100%identiteta) na druge viruse ili patogene ili na sekvence domaćina.

Sekvence nukleinske kiseline mogu se po potrebi pojačati metodama poznatim u tehnici. Na primjer, to se može postići, na primjer, polimeraznom lančanom reakcijom „PCR“ DNK ili RNK pomoću obrnute transkriptaze-PCR ili „RT-PCR“ (Vidi općenito PCR tehnologiju: principi i aplikacije za pojačavanje DNK (ur. HA Erlich, Freeman Press, NY, NY, 1992) PCR protokoli: Vodič za metode i primjene (ur. Innis, et al., Academic Press, San Diego, Kalifornija, 1990) Mattila i sur., Nukleinske kiseline Res. 19, 4967 (1991) Eckert et al., PCR metode i aplikacije 1, 17 (1991) PCR (ur. McPherson et al., IRL Press, Oxford) i US patent br. 4,683,202 objavljen 28. jula 1987. Mullisu) standardne PCR tehnike, kao što je na primjer RT-PCR u stvarnom vremenu koristeći interne i amplifikacijske prajmere, što rezultira povećanom osjetljivošću i brzinom te smanjenjem rizika od kontaminacije uzorka (vidi na primjer Higuchi, R., et al., „Kinetički PCR analiza: Praćenje reakcija amplifikacije DNK u stvarnom vremenu, “Bio/Technology, vol. 11, str. 1026-1030 (1993) Heid et al,“ Real Time Qua ntitativni PCT ”, Genome Research, 1996, str. 986-994 Gibson U E et al.,„ Nova metoda za kvantitativnu RT-PCR u stvarnom vremenu, ”Genome Res. 1996. 6 (10) oktobar: 995-1001), ili „Tacmanov“ pristup PCR-u, koji su opisali na primjer Holland et al, Proc. Natl. Akad. Sci., 88: 7276-7280 (1991), može se izvesti.

Druge prikladne metode amplifikacije i analitike uključuju produženje prajmera s jednom bazom (vidi na primjer US patent br. 6,004,744), mini sekvenciranje, lančanu reakciju ligaze (LCR) (vidi na primjer Wu i Wallace, Genomics 4, 560 (1989), Landegren et al., Science 241, 1077 (1988), pojačavanje transkripcije (Kwoh et al., Proc. Natl. Acad. Sci. USA 86, 1173 (1989)) i samoodrživa replikacija sekvence (Guatelli et al., Proc. Nat. Acad. Sci. USA, 87, 1874 (1990)) i amplifikaciju sekvence na bazi nukleinskih kiselina (NASBA). Posljednje dvije metode pojačanja uključuju izotermalne reakcije zasnovane na izotermičkoj transkripciji, koje proizvode i jednolančane RNA (ssRNA) i dvolančana DNK (dsDNA) kao produkti amplifikacije u omjeru od oko 30 odnosno 100 prema 1, respektivno.

Poremećaj povezan sa virusom SARS može se dijagnosticirati i pomoću antitijela usmjerenog protiv nukleinske kiseline ili sekvence aminokiselina virusa SARS koja specifično veže molekule nukleinske kiseline ili polipeptid. U alternativnoj izvedbi, antitijelo može biti usmjereno protiv SARS polipeptida, na primjer, S polipeptida ili njegovog fragmenta koji se nalazi na površini SARS viriona. Postupci za pripremu antitijela ili za ispitivanje vezivanja antitijela su dobro poznati u struci.

Serološka dijagnoza može uključivati ​​otkrivanje antitijela protiv polipeptida virusa SARS-a ili molekule nukleinske kiseline, na primjer, proteina nukleokapsida, proizvedenog kao odgovor na infekciju tehnikama kao što su indirektno testiranje fluorescentnih antitijela ili imunosorbenski testovi (ELISA). Poremećaj povezan sa virusom SARS također se može dijagnosticirati, na primjer, provođenjem studija hibridizacije sondi na uzorcima tkiva.

U nekim aspektima, dijagnostički testovi opisani ovdje ili poznati stručnjacima u ovoj oblasti mogu se provesti za varijante virusa SARS -a koje pokazuju povećanu patogenost, poput sojeva koji imaju suvišne sekvence.

U nekim izvedbama, reagensi za dijagnostiku (npr. Sonde, prajmeri, antitijela itd.) Mogu se isporučiti u kompletima koji mogu izborno uključivati ​​upute za upotrebu reagensa ili mogu uključivati ​​druge reagense za izvođenje odgovarajućeg testa, npr. Kontrole, standardi, puferi itd.

Terapija ili profilaksa za SARS-ove poremećaje povezane s virusom

Jedinjenja prema izumu mogu se takođe koristiti za obezbjeđivanje terapeutskih ili profilaktičkih sredstava za poremećaje povezane sa virusom SARS. U skladu s tim, takvi spojevi mogu se koristiti za liječenje sisavaca, na primjer, čovjeka ili domaće, domaće, domaće, divlje ili eksperimentalne životinje koja ima ili je u riziku od poremećaja povezanog s virusom SARS. Takvi spojevi mogu uključivati, bez ograničenja, spojeve koji ometaju replikaciju virusa SARS -a, ekspresiju proteina virusa SARS -a ili sposobnost virusa SARS -a da inficira ćeliju domaćina. Shodno tome, u nekim izvedbama, spojevi koji djeluju kao antagonisti polipeptida virusa SARS mogu se koristiti kao terapijski ili profilaktički za poremećaje povezane sa virusom SARS. U nekim izvedbama, pročišćeni polipeptidi virusa SARS -a mogu se koristiti kao, na primjer, konkurentni inhibitori za ometanje virusne funkcije. Na primjer, protein Spike koji nema funkcionalnu domenu ili ima neku drugu modifikaciju koja održava vezivanje, ali smanjuje ili uklanja patogenost, može se koristiti za ometanje virusne funkcije. U nekim realizacijama, antitijela koja vezuju polipeptide virusa SARS -a ili molekule nukleinskih kiselina, na primjer, humanizirana antitijela, mogu se koristiti kao terapeutska ili profilaktička sredstva.

U nekim izvedbama, spojevi virusa SARS mogu se koristiti kao vakcine, ili se mogu koristiti za razvoj vakcina. Na primjer, peptidi izvedeni iz dijelova proteina ili polipeptida virusa SARS koji se nalaze na vanjskoj strani viriona ili ćelijske površine mogu biti korisni za cjepiva ili za stvaranje terapijskih ili profilaktičkih antitijela.

"Vakcina" je sastav koji uključuje materijale koji izazivaju željeni imunološki odgovor. Vakcina može odabrati, aktivirati ili proširiti memorijske B i T ćelije imunološkog sistema kako bi, na primjer, omogućila eliminaciju zaraznih agenasa, poput virusa SARS -a, ili njegove komponente. U nekim realizacijama, vakcina uključuje odgovarajući nosač, kao što je pomoćno sredstvo, koje je sredstvo koje djeluje na nespecifičan način da poveća imunološki odgovor na određeni antigen ili na grupu antigena, omogućavajući smanjenje količinu antigena u bilo kojoj dozi vakcine ili smanjenje učestalosti doziranja koja je potrebna za stvaranje željenog imunološkog odgovora.

Vakcine prema izumu mogu uključivati ​​polipeptide virusa SARS -a i molekule nukleinske kiseline opisane ovdje, ili njihove imunogene fragmente. U nekim realizacijama, spike polipeptid virusa SARS, polipeptid ovojnice ili membranski glikoprotein ili njihovi fragmenti mogu biti prikladni za primjenu vakcine. U nekim realizacijama, vakcine mogu biti multivalentne i uključivati ​​jedan ili više epitopa iz polipeptida virusa SARS -a ili njegovog fragmenta.

U nekim izvedbama izuma, vakcina može uključivati ​​živi ili ubijeni mikroorganizam, na primjer, virus SARS -a ili njegovu komponentu. Ako se koristi živi SARS virus, koji se može primijeniti u obliku oralne vakcine, može sadržavati nepovratne genetske promjene (na primjer, velika brisanja ili umetanja u genomski niz) koje smanjuju ili uklanjaju virulenciju virusa ("Oslabljeni virus"), ali ne i njegovu indukciju imunološkog odgovora. U nekim realizacijama, živa vakcina može uključivati ​​oslabljeni mikroorganizam koji nije SARS (npr. Bakterija ili virus, poput virusa vakcinije) koji je sposoban da eksprimira polipeptid virusa SARS ili njegov imunogeni fragment kako je ovdje opisano. U nekim izvedbama, vakcina može uključivati ​​polipeptide virusa SARS -a ili molekule nukleinske kiseline s modifikacijama koje olakšavaju davanje. Na primjer, polipeptid SARS virusa koji se ne probavlja ili molekula nukleinske kiseline mogu se koristiti za oralnu primjenu, a modifikacija pogodna za inhalaciju može se koristiti za primjenu u pluća.

"Vakcina protiv nukleinske kiseline" ili "DNK vakcina", kako se ovdje koristi, je konstrukt nukleinske kiseline koji sadrži polinukleotid koji kodira polipeptidni antigen, posebno podsljedu antigenih aminokiselina identifikovanu ovdje opisanim metodama ili poznatu u struci. Konstrukt nukleinske kiseline može također uključivati ​​transkripcijske promotorske elemente, pojačivačke elemente, signale spajanja, signale prekidanja i poliadenilacije i druge sekvence nukleinske kiseline. Tako se vakcina protiv nukleinske kiseline općenito uvodi u subjekt životinje koristeći, na primjer, jedan ili više DNA plazmida uključujući jednu ili više sekvenci koje kodiraju antigen (na primjer, polipeptid ovojnice virusa SARS-a ili membranska glikoproteinska sekvenca) koje su sposobne transficirati stanice u vivo i induciranje imunološkog odgovora (vidi, na primjer, Whalen RG et al. DNK-posredovanu imunizaciju i energetski imunološki odgovor na površinski antigen hepatitisa B. Clin Immunol Immunopathol 1995 75: 1-12 Wolff JA i sur. Direktan prijenos gena u mišićni mišić in vivo. Nauka 1990 247: 1465-8 Fynan EF i dr. DNK vakcine: zaštitne imunizacije roditeljskim, mukoznim i genskim inokulacijama. Proc Natl Acad Sci USA 1993 90: 11478-82). U nekim izvedbama, biblioteka fragmenata nukleinske kiseline može se pripremiti kloniranjem genomske DNK virusa SARS -a u vektor ekspresije plazmida korištenjem poznatih tehnika, a biblioteka se zatim koristiti kao vakcina protiv nukleinske kiseline (vidi na primjer Barry MA, et al. Zaštita od mikoplazme infekcija pomoću imunološke biblioteke ekspresije. Nature 1995 377: 632-5).

Subjektu se daje standardna metoda vakcine protiv nukleinske kiseline. Kičmenjak se može davati parenteralno, potkožno, intravenozno, intraperitonealno, intradermalno, intramuskularno, lokalno, oralno, rektalno, nazalno, bukalno, vaginalno, inhalacijskim sprejom ili putem implantiranog rezervoara u formulacijama za doziranje koje sadrže uobičajene netoksične, fiziološki prihvatljive nosače ili vozila. Alternativno, subjektu se daje vakcina protiv nukleinske kiseline upotrebom instrumenta za ubrzavanje čestica ili bombardovanja („genski pištolj“). Oblik u kojem se primjenjuje (na primjer, kapsula, tableta, otopina, emulzija) djelomično će ovisiti o načinu na koji se daje. Na primjer, za primjenu sluznice mogu se koristiti kapi za nos, inhalatori ili supozitorije. Vakcina protiv nukleinske kiseline može se primijeniti zajedno sa poznatim adjuvansima. Adjuvans se daje u dovoljnoj količini, koja je dovoljna za stvaranje pojačanog imunološkog odgovora na cjepivo protiv nukleinske kiseline. Dodatak se može primijeniti prije (npr. 1 ili više dana prije) inokulacije vakcinom protiv nukleinske kiseline istovremeno (npr. U roku od 24 sata od) inokulacije vakcinom protiv nukleinske kiseline istovremeno (istovremeno) sa cjepivom protiv nukleinske kiseline (npr. adjuvans se pomiješa sa vakcinom nukleinske kiseline i smjesa se daje kičmenjacima) ili nakon (npr. 1 ili više dana nakon) inokulacije vakcinom protiv nukleinske kiseline. Adjuvans se može primijeniti i više od jednog puta (npr. Prije inokulacije vakcinom protiv nukleinske kiseline, a također i nakon inokulacije cjepivom protiv nukleinske kiseline). Kako se ovdje koristi, izraz "zajedno sa" obuhvaća bilo koji vremenski period, uključujući one koji su ovdje posebno opisani i kombinacije ovdje posebno opisanih vremenskih perioda, tokom kojih se adjuvans može primijeniti tako da generira pojačan imunološki odgovor na nukleinsku kiselinu vakcina (npr. povećan titar antitijela na antigen kodiran vakcinom protiv nukleinske kiseline ili povećan titar antitijela na patogeni agens). Adjuvant i vakcina protiv nukleinske kiseline mogu se primijeniti na približno isto mjesto na kralježnjaku, na primjer, i adjuvant i cjepivo protiv nukleinske kiseline se daju na označenom mjestu na udu subjekta.

U nekim izvedbama, ekspresija gena virusa SARS-a ili kodirajućeg ili nekodirajućeg područja od interesa može se inhibirati ili spriječiti upotrebom tehnologije RNA interferencije (RNAi), vrste post-transkripcijskog utišavanja gena. RNAi se može koristiti za stvaranje funkcionalnog „nokauta“, tj. Sistema u kojem se smanjuje ekspresija gena ili kodirajućeg ili nekodirajućeg područja od interesa, što rezultira ukupnim smanjenjem kodiranog proizvoda. Kao takav, RNAi se može izvesti tako da cilja nukleinsku kiselinu od interesa ili njen fragment ili varijantu, kako bi se smanjila njegova ekspresija i nivo aktivnosti proizvoda koji kodira. Takav sistem se može koristiti za terapiju ili profilaksu, kao i za funkcionalne studije. RNAi je opisan u, na primjer, objavljenim američkim patentnim prijavama 20020173478 (Gewirtz objavljen 21. novembra 2002.) i 20020132788 (Lewis et al. Objavljen 7. novembra 2002.). Reagensi i kompleti za izvođenje RNAi komercijalno su dostupni na primjer Ambion Inc. (Austin, Tex., USA) i New England Biolabs Inc. (Beverly, Mass., USA).

Inicijalni agens za RNAi u nekim sistemima smatra se molekulom dsRNA koji odgovara ciljnoj nukleinskoj kiselini. Zatim se smatra da se dsRNA cijepa na kratke interferirajuće RNA (siRNA) koje su dugačke 21-23 nukleotida (dupleksi od 19-21 bp, svaki sa 2 nukleotidna 3 'prevjesa). Enzim za koji se smatra da utječe na ovaj prvi korak cijepanja naziva se "Dicer" i kategoriziran je kao član Rnase III porodice dsRNA-specifičnih ribonukleaza. Alternativno, RNAi se može postići direktnim unosom u ćeliju ili generiranjem unutar ćelije unošenjem u ćeliju odgovarajućeg prekursora (npr. Vektora itd.) Takve molekule slične siRNA ili siRNA. SiRNA se tada može povezati s drugim unutarstaničnim komponentama kako bi se formirao kompleks za utišavanje induciran RNA (RISC). Tako formirani RISC može naknadno ciljati na transkript od interesa putem interakcija uparivanja baza između njegove siRNA komponente i ciljnog transkripta na osnovu homologije, što rezultira cijepanjem ciljnog transkripta otprilike 12 nukleotida sa 3 ′ kraja siRNA. Tako se ciljna mRNA cijepa i smanjuje se nivo proteinskog proizvoda koji kodira.

RNAi se može postići uvođenjem prikladnih in vitro sintetiziranih siRNA ili molekula sličnih siRNA u ćelije. RNAi se, na primjer, može izvesti korištenjem kemijski sintetizirane RNA, za koju se odgovarajući molekuli RNA mogu kemijski sintetizirati poznatim metodama. Alternativno, pogodni ekspresijski vektori se mogu koristiti za transkripciju takve RNA bilo in vitro ili in vivo. In vitro transkripcija osjetilnih i antisens lanaca (kodiranih sekvencama prisutnim na istom vektoru ili na odvojenim vektorima) može se izvršiti upotrebom, na primjer, T7 RNA polimeraze, u kojem slučaju vektor može sadržavati prikladnu kodirajuću sekvencu operativno vezanu za T7 promotor . In vitro transkribovana RNK može se u realizacijama obraditi (npr. Korišćenjem E. coli RNase III) in vitro do veličine pogodne za RNAi. Transkripti osjetila i antisensa kombinirani su u RNA dupleks koji se uvodi u ciljnu ćeliju od interesa. Mogu se koristiti i drugi vektori, koji eksprimiraju male RNA ukosnice (shRNA) koje se mogu preraditi u molekule slične siRNA. U struci su poznati različiti vektorski zasnovani postupci. U tehnici su poznati različiti postupci za uvođenje takvih vektora u ćelije, bilo in vitro ili in vivo (npr. Genska terapija).

Shodno tome, u jednoj izvedbi, ekspresija polipeptida uključujući aminokiselinsku sekvencu koja je u osnovi identična sekvenci SARS virusa može se inhibirati unošenjem ili generiranjem unutar ćelije molekule slične siRNA ili siRNA koja odgovara molekuli nukleinske kiseline koja kodira polipeptid ili njegovog fragmenta ili nukleinskoj kiselini homolognoj. U različitim aspektima, ova metoda može uključivati ​​direktno davanje siRNA ili molekule slične siRNA u ćeliju, ili upotrebu gore opisanih metoda zasnovanih na vektorima. U jednoj izvedbi, siRNA ili molekula slična siRNA ima dužinu manju od oko 30 nukleotida. U sledećoj realizaciji, molekule slične siRNA ili siRNA imaju dužinu od 21-23 nukleotida. U jednoj izvedbi, siRNA ili molekule slične siRNA sadrže i dupleksni dio od 19-21 bp, pri čemu svaki lanac ima 2 nukleotida 3 'prevjesa. U realizacijama, molekula slična siRNA ili siRNA je u suštini identična nukleinskoj kiselini koja kodira polipeptid ili njegov fragment ili varijantu (ili fragment varijante). Takva varijanta može kodirati protein koji ima aktivnost polipeptida virusa SARS. U realizacijama, osjetilni lanac siRNA ili molekule slične siRNA je u suštini identičan molekulu nukleinske kiseline virusa SARS ili njegovom fragmentu (RNA koja ima U umjesto T ostataka DNK sekvence).

Ekspresija virusa SARS -a

Općenito, polipeptidi virusa SARS-a prema izumu mogu se proizvesti transformacijom prikladne ćelije domaćina sa cijelim ili dijelom genomske molekule ili cDNA kodiranjem polipeptida virusa SARS-a ili njegovim fragmentom (npr. Ovdje opisanom genomskom DNK ili cDNK) u odgovarajućem ekspresnom vozilu. Oni koji su vješti u području molekularne biologije shvatit će da se bilo koji od širokog spektra ekspresijskih sustava može koristiti za dobijanje rekombinantnog proteina. Precizna korištena ćelija domaćin nije kritična za pronalazak. Polipeptid virusa SARS -a može se proizvesti u prokariotskom domaćinu (npr. E. coli ili virus, na primjer, koronovirus kao što je humani OC43 ili 229E, goveđi koronavirus ili virus koji se koristi za gensku terapiju, poput adenovirusa) ili u eukariotskom domaćinu (npr. Saccharomyces cerevisiae, ćelije insekata, na primjer, ćelije Sf21 ili ćelije sisara, na primjer, ćelije COS 1, NIH 3T3, VeroE6 ili HeLa). Takve ćelije su dostupne iz širokog spektra izvora (npr. American Type Culture Collection, Rockland, Md. Također, vidi, npr., Ausubel et al., Current Protocols in Molecular Biology, John Wiley & amp Sons, New York, 1994) . Način transformacije ili transfekcije i izbor ekspresijskog nosača ovisit će o odabranom sistemu domaćinu. Metode transformacije i transfekcije opisane su, na primjer, u Ausubel et al. (supra) ekspresijska sredstva mogu se izabrati među onima koja su navedena, npr. u Cloning Vectors: A Laboratory Manual, P. H. Pouwels et al, 1985, Supp. 1987) ili iz komercijalno dostupnih izvora. Prikladni životinjski modeli, npr. može se upotrijebiti životinjski model tvora ili bilo koji drugi životinjski model pogodan za analizu infekcije virusom SARS ili ekspresiju molekula nukleinske kiseline virusa SARS.

U alternativnoj izvedbi, može se koristiti sistem ekspresije bakulovirusa (koristeći, na primjer, vektor pBacPAK9) dostupan iz kompanije Clontech (Pal Alto, Kalifornija). Po želji, ovaj sistem se može koristiti zajedno s drugim tehnikama ekspresije proteina, na primjer, pristupom myc tag -a koji su opisali Evan i sur. (Mol. Cell Biol. 5: 3610-3616, 1985). U alternativnoj izvedbi, polipeptid virusa SARS-a može se proizvesti stabilno transficiranom ćelijskom linijom sisavaca. Brojni vektori pogodni za stabilnu transfekciju ćelija sisavaca dostupni su javnosti, na primjer, vidi Pouwels et al (gore) Metode za konstruiranje takvih ćelijskih linija također su javno dostupne, na primjer, u Ausubel et al. (gore). U jednom primjeru, cDNA koja kodira polipeptid virusa SARS klonirana je u ekspresijski vektor koji uključuje gen za dihidrofolat reduktazu (DHFR). Za integraciju plazmida i, prema tome, gena koji kodira polipeptid virusa SARS u kromosom ćelije domaćina bira se uključivanje 0,01-300 μM metotreksata u medij ćelijske kulture (kako je opisano u Ausubel et al., Gore). Ova dominantna selekcija može se postići u većini tipova ćelija. Ekspresija rekombinantnog proteina može se povećati DHFR posredovanom amplifikacijom transficiranog gena. Metode odabira ćelijskih linija koje nose amplifikacije gena opisane su u Ausubel et al. (gore) takve metode općenito uključuju produženu kulturu u podlozi koja sadrži postupno rastuće razine metotreksata. Ekspresivni vektori koji sadrže DHFR obično se koriste u tu svrhu uključuju pCVSEII-DHFR i pAdD26SV (A) (opisano u Ausubel et al., Gore). Bilo koja od gore opisanih stanica domaćina ili, po mogućnosti, CHO ćelijska linija s nedostatkom DHFR-a (npr., CHO DHFR-ćelije, pristupni broj ATCC CRL 9096) su među ćelijama-domaćinima koje se preferiraju za odabir stabilno transfektiranog DHFR-om ćelijske linije ili amplifikacije gena posredovane DHFR-om.

Nakon što se rekombinantni polipeptid SARS virusa eksprimira, izolira se, na primjer, pomoću afinitetne hromatografije. U jednom primjeru, polipeptidno antitijelo protiv virusa SARS (npr. Proizvedeno kako je ovdje opisano) može se pričvrstiti na stupac i upotrijebiti za izolaciju polipeptida virusa SARS. Lisa i frakcioniranje stanica koje sadrže polipeptde virusa SARS-a prije afinitetne hromatografije mogu se izvesti standardnim metodama (vidi, na primjer, Ausubel et al., Gore). U drugom primjeru, polipeptidi virusa SARS mogu se pročistiti ili znatno pročistiti iz mješavine spojeva poput ekstrakta ili supernatanta dobivenog iz stanica (Ausubel et al., Gore). Standardne tehnike pročišćavanja mogu se koristiti za postupno uklanjanje nepoželjnih spojeva iz smjese sve dok se ne izolira jedno jedinjenje ili minimalni broj efikasnih spojeva.

Nakon što se izolira, rekombinantni protein može se, ako se želi, dodatno pročistiti, na primjer, tečnom hromatografijom visokih performansi (vidi, npr., Fisher, Laboratory Techniques In Biochemistry And Molecular Biology, ur., Work and Burdon, Elsevier, 1980).

Polipeptidi prema pronalasku, posebno kratki peptidni fragmenti virusa SARS -a, mogu se također proizvesti kemijskom sintezom (npr. Metodama opisanim u Sintezi čvrstih faza peptida, 2. izdanje, 1984. The Pierce Chemical Co., Rockford, Ill.).

Ove opće tehnike ekspresije i pročišćavanja polipeptida mogu se također koristiti za proizvodnju i izolaciju korisnih proteinskih fragmenata ili analoga virusa SARS (ovdje opisanih).

U nekim alternativnim ostvarenjima, polipeptid SARS -a mogao je pričvrstiti bilo koju od različitih oznaka. Oznake mogu biti oznake aminokiselina ili kemijske oznake i mogu se dodati u svrhu pročišćavanja (na primjer oznaka sa 6-histidinom za pročišćavanje preko niklova stupca). U drugim poželjnim ostvarenjima, različite oznake se mogu koristiti kao sredstva za otkrivanje vezivanja SARS polipeptida za drugi polipeptid, na primjer za receptor na ćelijskoj površini. Alternativno, SARS DNA ili RNA mogu biti označene za detekciju, na primjer u testu hibridizacije. Nukleinske kiseline ili proteini virusa SARS, ili njihovi derivati, mogu se direktno ili indirektno označiti, na primjer, radioskopom, fluorescentnim spojem, bioluminiscentnim spojem, hemiluminiscentnim spojem, metalnim kelatorom ili enzimom. Oni koji su obični u struci znat će za druge odgovarajuće oznake ili će ih moći utvrditi, koristeći rutinsko eksperimentiranje. U još jednoj izvedbi izuma, ovdje opisani polipeptidi ili njihovi derivati ​​povezani su s toksinima.

Izolacija i identifikacija dodatnih molekula virusa SARS -a

Na osnovu ovdje opisanih sekvenci virusa SARS-a, izolacija i identifikacija dodatnih sekvenci povezanih sa virusom SARS-a, poput gena virusa SARS-a i dodatnih sojeva ili izolata virusa SARS-a, omogućena je korištenjem standardnih tehnika. Osim toga, ovdje navedene sekvence virusa SARS -a također pružaju osnovu za identifikaciju homolognih sekvenci iz drugih vrsta i rodova iz prokariota i eukariota, poput virusa, bakterija, gljivica, parazita, kvasca i/ili sisavaca. U nekim realizacijama, ovdje opisane sekvence nukleinskih kiselina mogu se koristiti za dizajniranje sondi ili prajmera, uključujući degenerirane oligonukleotidne sonde ili prajmere, na osnovu sekvence bilo kojeg lanca DNA. Sonde ili početnice se tada mogu koristiti za skrining genomskih ili cDNA biblioteka za sekvence iz, na primjer, prirodno prisutnih varijanti ili izolata SARS virusa, koristeći standardne tehnike amplifikacije ili hibridizacije.

U nekim izvedbama, partneri vezanja mogu se identificirati označavanjem polipeptida iz izuma (npr. Onih koji su u biti identični polipeptidima virusa SARS -a koji su ovdje opisani) sa sekvencom epitopa (npr. FLAG ili 2HA) i isporukom u ćelije domaćina, bilo putem transfekcija odgovarajućim vektorom koji sadrži sekvencu nukleinske kiseline koja kodira polipeptid izuma, nakon čega slijedi imunoprecipitacija i identifikacija veznog partnera. Ćelije mogu biti inficirane sojevima koji eksprimiraju FLAG ili 2HA fuzije, nakon čega slijedi liza i imunoprecipitacija s anti-FLAG ili anti-2HA antitijelima. Vezujući partneri mogu se identificirati masenom spektroskopijom. Ako se polipeptid iz izuma ne proizvodi u dovoljnim količinama, takva metoda možda neće isporučiti dovoljno obilježenog proteina za identifikaciju svog partnera. Kao dio komplementarnog pristupa, svaki polipeptid prema izumu može se klonirati u vektor transfekcije sisara spojen, na primjer, 2HA, GFP i/ili FLAG. Nakon transfekcije, HeLa ćelije se mogu lizirati i obilježeni polipeptid imunoprecipitirati. Vezujući partner može se identificirati pomoću SDS PAGE, nakon čega slijedi masena spektroskopija.

U nekim realizacijama, polipeptidi ili antitijela prema pronalasku mogu se označiti, proizvesti i koristiti, na primjer, na kolonama sa afinitetom i/ili u imunološkim testovima za identifikaciju i/ili potvrdu identificiranih ciljnih spojeva. FLAG, HA i/ili His označeni proteini mogu se koristiti za takve kolone sa afinitetom za izvlačenje faktora ćelije domaćina iz ćelijskih ekstrakata, a svaki pogodak se može potvrditi standardnim testovima vezivanja, krivama zasićenja i drugim metodama kako su ovdje opisane ili poznate oni koji su vešti u umetnosti.

U nekim izvedbama, dva hibridna sistema mogu se koristiti za proučavanje interakcija protein-protein. Ovdje opisane sekvence nukleinskih kiselina, ili sekvence koje su im u suštini identične, mogu se klonirati u pBT plazmid mamca dva hibridna sistema, a komercijalno dostupna biblioteka slezine miša od 5 × 106 nezavisnih klonova može se koristiti kao ciljna biblioteka za mamci. Potencijalni pogoci mogu se dodatno okarakterizirati oporavkom plazmida i ponovnom transformacijom radi smanjenja lažno pozitivnih rezultata koji proizlaze iz klonskih varijanti mamaca i bibliotečkih ciljnih klonova koji aktiviraju reporterske gene neovisno o kloniranom mamcu. Ponovljivi pogoci mogu se dalje proučavati kako je ovdje opisano.

Virulencija se može ispitati kako je ovdje opisano ili poznato onima koji su stručni u ovoj oblasti. Nakon što su kodirane sekvence identificirane, mogu se izolirati standardnim tehnikama kloniranja i umetnuti u bilo koji prikladan vektor ili replikon za, na primjer, proizvodnju polipeptida. Takvi vektori i replici uključuju, bez ograničenja, bakteriofag X (E. coli), pBR322 (E. coli), pACYC177 (E. coli), pKT230 (gram-negativne bakterije), pGV1 106 (gram-negativne bakterije), pLAFR1 (gram-negativne bakterije), pME290 (ne-E. coli gram-negativne bakterije), pHV14 (E. coli i Bacillus subtilis), pBD9 (Bacillus), pIJ61 (Streptomyces), pUC6 (Streptomyces), YIp5 (Saccharomyces), YCp19 (Saccharomyces) ili goveđi papiloma virus (ćelije sisara). Općenito, polipeptidi iz ovog izuma mogu se proizvesti u bilo kojoj prikladnoj stanici domaćinu transformiranoj ili transficiranoj odgovarajućim vektorom. Način transformacije ili transfekcije i izbor ekspresijskog nosača ovisit će o odabranom sistemu domaćinu. Mogu se koristiti različiti sistemi ekspresije, a precizna ćelija domaćin nije kritična za pronalazak. Na primjer, polipeptid prema izumu može se proizvesti u prokariotskom domaćinu (npr. E. coli) ili u eukariotskom domaćinu (npr. Saccharoinyces cerevisiae, ćelije insekata, npr. ćelije Sf21 ili ćelije sisara, npr. NIH 3T3, HeLa ili COS ćelije). Takve ćelije su dostupne iz širokog spektra izvora (npr. Američka zbirka kulture tipova, Manassus, Va.). Bakterijski ekspresijski sistemi za proizvodnju polipeptida uključuju E. coli ekspresijski sistem pET (Novagen, Inc., Madison, Vis.), i sistem ekspresije pGEX (Pharmacia).

U jednom aspektu, spojevi prema izumu uključuju molekule nukleinske kiseline i polipeptide virusa SARS, kao što su sekvence otkrivene na slikama i u tabelama ovdje, te u cijeloj specifikaciji, i njihovi fragmenti. U alternativnim ostvarenjima, spojevi prema izumu mogu biti molekuli nukleinskih kiselina koji imaju dužinu od najmanje 10 nukleotida i koji su izvedeni iz ovdje opisanih sekvenci. U alternativnim ostvarenjima, spojevi prema izumu mogu biti peptidi koji imaju najmanje 5 aminokiselina dužine i koji su izvedeni iz ovdje opisanih sekvenci.

U alternativnim izvedbama, spoj prema izumu može biti nepeptidna molekula, kao i peptid ili analog peptida. Peptid ili analog peptida općenito će biti što je moguće manji zadržavajući punu biološku aktivnost. Nepeptidni molekul može biti bilo koji molekul koji pokazuje biološku aktivnost kako je ovdje opisano ili poznato u struci. Biološka aktivnost može se, na primjer, mjeriti u smislu sposobnosti izazivanja citotoksičnog odgovora, posredovanja replikacije DNK ili bilo koje druge funkcije molekula virusa SARS -a.

Spojevi se mogu pripraviti, na primjer, zamjenom, brisanjem ili umetanjem aminokiselinskog ostatka SARS peptida ili analoga peptida, kako je ovdje opisano, s drugim konzervativnim aminokiselinskim ostacima, tj. Ostacima sličnih fizičkih, bioloških ili kemijskih svojstava, i skrining za biološku funkciju.

U struci je dobro poznato da se u strukturu polipeptida mogu unijeti neke modifikacije i promjene bez bitne promjene biološke funkcije tog peptida, kako bi se dobio biološki ekvivalentan polipeptid. Takve se izmjene mogu napraviti u svrhu izmjene funkcije, ili radi olakšavanja primjene ili poboljšanja stabilnosti ili sprječavanja kvara, na primjer, za terapijske svrhe. Na primjer, neprobavljivo jedinjenje virusa SARS -a prema izumu može se koristiti za oralnu primjenu, a modifikacija pogodna za inhalaciju može se koristiti za primjenu u pluća ili dodavanje vodeće sekvence može povećati nivoe ekspresije proteina.

U jednom aspektu izuma, peptidi ili epitopi izvedeni iz SARS virusa mogu uključivati ​​peptide koji se razlikuju od dijela nativnog lidera, proteina ili SARS virusa sekvencama konzervativnim zamjenama aminokiselina. Peptidi i epitopi ovog izuma takođe se protežu na biološki ekvivalentne peptide koji se razlikuju od dijela niza novih peptida prema ovom izumu konzervativnim zamjenama aminokiselina. Kako se ovdje koristi, izraz "konzervirane zamjene aminokiselina" odnosi se na zamjenu jedne aminokiseline drugom na određenoj lokaciji u peptidu, gdje se zamjena može izvršiti bez značajnog gubitka relevantne funkcije. Prilikom ovih promjena, zamjene sličnih aminokiselinskih ostataka mogu se izvršiti na osnovu relativne sličnosti supstituenata bočnog lanca, na primjer, njihove veličine, naboja, hidrofobnosti, hidrofilnosti i slično, a takve se zamjene mogu ispitati za njihovu rutinskim testiranjem utiče na funkciju peptida.

U nekim izvedbama, konzervirane aminokiselinske supstitucije mogu se izvršiti gdje je aminokiselinski ostatak zamijenjen drugim koji ima sličnu vrijednost hidrofilnosti (npr. Unutar vrijednosti plus ili minus 2,0), gdje sljedeće može biti aminokiselina koja ima hidropatski indeks od oko -1,6, kao što su Tyr (-1,3) ili Pro (-1,6) s pripisuju se aminokiselinskim ostacima (kako je detaljno opisano u US patentu br. 4,554,101, ovdje uključenom referencom): Arg (+3,0) Lys (+ 3.0) Asp (+3.0) Glu (+3.0) Ser (+0.3) Asn (+0.2) Gln (+0.2) Gly (0) Pro (−0.5) Thr (−0.4) Ala (−0.5) His (−0.5 ) Cys (−1.0) Met (−1.3) Val (−1.5) Leu (−1.8) Ile (−1.8) Tyr (−2.3) Phe (−2.5) i Trp (−3.4).

U alternativnim izvedbama, konzervirane aminokiselinske supstitucije mogu se izvršiti gdje je aminokiselinski ostatak zamijenjen drugim sa sličnim hidropatskim indeksom (npr. Unutar vrijednosti plus ili minus 2,0). U takvim izvedbama, svakom aminokiselinskom ostatku može se dodijeliti hidropatski indeks na osnovu njegove hidrofobnosti i karakteristika naboja, kako slijedi: Ile (+4,5) Val (+4,2) Leu (+3,8) Phe (+2,8) Cys (+ 2.5) Met (+1,9) Ala (+1,8) Gly (−0,4) Thr (−0,7) Ser (−0,8) Trp (−0,9) Tyr (−1,3) Pro (−1,6) His (−3,2) Glu ( - 3.5) Gln (−3,5) Asp (−3,5) Asn (−3,5) Lys (−3,9) i Arg (−4,5).

U alternativnim izvedbama, konzervirane zamjene aminokiselina mogu se izvršiti gdje je aminokiselinski ostatak zamijenjen drugim u istoj klasi, gdje su aminokiseline podijeljene u nepolarne, kisele, bazične i neutralne klase, kako slijedi: nepolarne: Ala, Val, Leu, Ile, Phe, Trp, Pro, Met kisela: Asp, Glu bazična: Lys, Arg, Njegova neutralna: Gly, Ser, Thr, Cys, Asn, Gln, Tyr.

Konzervativne promjene aminokiselina mogu uključivati ​​zamjenu L-aminokiseline odgovarajućom D-aminokiselinom, konzervativnom D-aminokiselinom ili prirodnim, genetski ne kodiranim oblikom aminokiseline, kao i konzervativna supstitucija L-aminokiseline. Ne-genetski kodirane aminokiseline koje se pojavljuju u prirodi uključuju beta-alanin, 3-amino-propionsku kiselinu, 2,3-diamino propionsku kiselinu, alfa-aminoizobutenu kiselinu, 4-amino-maslačnu kiselinu, N-metilglicin (sarkozin), hidroksiprolin, ornitin, citrulin, t-butilalanin, t-butilglicin, N-metilizoleucin, fenilglicin, cikloheksilalanin, norleucin, norvalin, 2-naptilalanin, piridilalanin, 3-benzotienil alanin, 4-klorofenilapin, , penicilamin, 1,2,3,4-tetrahidro-izokinolin-3-karboksilna kiselina, beta-2-tienilalanin, metionin sulfoksid, homoarginin, N-acetil lizin, 2-amino maslačna kiselina, 2-amino maslačna kiselina, 2, 4, -diamino maslačna kiselina, p-aminofenilalanin, N-metilvalin, homocistein, homoserin, cisteinska kiselina, epsilon-amino heksanoična kiselina, delta-amino valerična kiselina ili 2,3-diaminomaslačna kiselina.

U alternativnim izvedbama, konzervativne promjene aminokiselina uključuju promjene zasnovane na razmatranju hidrofilnosti ili hidrofobnosti, veličine ili zapremine ili naboja.Aminokiseline se općenito mogu okarakterizirati kao hidrofobne ili hidrofilne, ovisno prvenstveno o svojstvima bočnog lanca aminokiselina. Hidrofobna aminokiselina pokazuje hidrofobnost veću od nule, a hidrofilna aminokiselina pokazuje hidrofilnost manju od nule, na osnovu normalizirane skale hidrofobnosti konsenzusa Eisenberga i ostalih (J. Mol. Bio. 179: 125-142, 184). Genetski kodirane hidrofobne aminokiseline uključuju Gly, Ala, Phe, Val, Leu, Ile, Pro, Met i Trp, a genetski kodirane hidrofilne aminokiseline uključuju Thr, His, Glu, Gln, Asp, Arg, Ser i Lys. Ne-genetski kodirane hidrofobne aminokiseline uključuju t-butilalanin, dok ne-genetski kodirane hidrofilne aminokiseline uključuju citrulin i homocistein.

Hidrofobne ili hidrofilne aminokiseline mogu se dalje podijeliti na osnovu karakteristika njihovih bočnih lanaca. Na primjer, aromatična aminokiselina je hidrofobna aminokiselina sa bočnim lancem koji sadrži najmanje jedan aromatski ili heteroaromatski prsten, koji može sadržavati jedan ili više supstituenata kao što su -OH, -SH, -CN, -F, -Cl, - Br, —I, —NO2, —NO, —NH2, -NHR, -NRR, -C (O) R, -C (O) OH, -C (O) OR, -C (O) NH2, —C (O) NHR, —C (O) NRR itd., Gdje je R nezavisno (C1-C6) alkil, supstituisan (C1-C6) alkil, (C1-C6) alkenil, supstituisan (C1-C6) alkenil, (C1-C6) alkinil, supstituisan (C1-C6) alkinil, (C5-C20) aril, supstituisan (C5-C20) aril, (C6-C26) alkaril, supstituisan (C6-C26) alkaril, 5-20-člani heteroaril, supstituirani 5-20-člani heteroaril, 6-26-člani alheteroaril ili supstituirani 6-26-člani alheteroaril. Genetski kodirane aromatične aminokiseline uključuju Phe, Tyr i Tryp, dok ne genetski kodirane aromatske aminokiseline uključuju fenilglicin, 2-naptilalanin, beta-2-tienilalanin, 1,2,3,4-tetrahidro-izokinolin-3-karboksilnu kiselinu , 4-klorofenilalanin, 2-fluoropbenilalanin 3-fluorofenilalanin i 4-fluorofenilalanin.

Apolarna aminokiselina je hidrofobna aminokiselina sa bočnim lancem koji se ne napuni pri fiziološkom pH i koji ima veze u kojima par elektrona koje dijele dva atoma općenito jednako drže svaki od dva atoma (tj. lanac nije polarni). Genetski kodirane apolarne aminokiseline uključuju Gly, Leu, Val, Ile, Ala i Met, dok ne genetski kodirane apolarne aminokiseline uključuju cikloheksilalanin. Apolarne aminokiseline mogu se dalje podijeliti tako da uključuju alifatske aminokiseline, koje su hidrofobne aminokiseline sa alifatskim ugljikovodičnim bočnim lancem. Genetski kodirane alifatske aminokiseline uključuju Ala, Leu, Val i Ile, dok negenetski kodirane alifatske aminokiseline uključuju norleucin.

Polarna aminokiselina je hidrofilna aminokiselina sa bočnim lancem koji se ne napuni pri fiziološkom pH, ali koja ima jednu vezu u kojoj par elektrona koje dijele dva atoma bliže drži jedan od atoma. Genetski kodirane polarne aminokiseline uključuju Ser, Thr, Asn i Gln, dok ne genetski kodirane polarne aminokiseline uključuju citrulin, N-acetil lizin i metionin sulfoksid.

Kisela aminokiselina je hidrofilna aminokiselina sa pKa vrijednošću bočnog lanca manjom od 7. Kisele aminokiseline obično imaju negativno nabijene bočne lance pri fiziološkom pH zbog gubitka vodikovog iona. Genetski kodirane kisele aminokiseline uključuju Asp i Glu. Bazna aminokiselina je hidrofilna aminokiselina sa vrijednošću pKa bočnog lanca većom od 7. Osnovne aminokiseline obično imaju pozitivno nabijene bočne lance pri fiziološkom pH zbog asocijacije na hidronijev ion. Genetski kodirane osnovne aminokiseline uključuju Arg, Lys i His, dok ne-genetski kodirane bazične aminokiseline uključuju neciklične aminokiseline ornitin, 2,3, -diaminopropionsku kiselinu, 2,4-diaminomaslačnu kiselinu i homoarginin.

Stručnjak u ovoj oblasti će cijeniti da gornje klasifikacije nisu apsolutne i da se aminokiselina može klasificirati u više od jedne kategorije. Osim toga, aminokiseline se mogu klasificirati na osnovu poznatog ponašanja i ili karakterističnih hemijskih, fizičkih ili bioloških svojstava na osnovu navedenih testova ili u poređenju sa prethodno identifikovanim aminokiselinama. Aminokiseline mogu također uključivati ​​bifunkcionalne dijelove koji imaju bočne lance slične aminokiselinama.

Konzervativne promjene mogu također uključivati ​​zamjenu hemijski deriviranog dijela za nederivatizirani ostatak, na primjer, reakcijom funkcionalne bočne grupe aminokiseline. Dakle, ove supstitucije mogu uključivati ​​spojeve čije su slobodne amino grupe izvedene u aminske hidrokloride, p-toluen sulfonilne grupe, karbobenzoksi grupe, t-butiloksikarbonilne grupe, kloroacetilne grupe ili formilne grupe. Slično, slobodne karboksilne grupe mogu se derivatizirati u soli, metil i etil estere ili druge vrste estera ili hidrazida, a bočni lanci se mogu derivatizirati u oblike O-acil ili O-alkil derivata za slobodne hidroksilne grupe ili N-im-benzilhistidin za imidazol dušik histidina. Analogi peptida također uključuju aminokiseline koje su kemijski promijenjene, na primjer, metilacijom, amidacijom C-terminalne aminokiseline alkilaminom kao što je etilamin, etanolamin ili etilen diamin, ili acilacijom ili metilacijom bočnog lanca aminokiseline (kao što je acilacija epsilon amino grupe lizina). Analogi peptida mogu također uključivati ​​zamjenu amidne veze u peptidu sa supstituiranim amidom (na primjer, grupe formule -C (O) -NR, gdje je R (C1-C6) alkil, (C1-C6) alkenil, (C1-C6) alkinil, supstituisan (C1-C6) alkil, supstituisan (C1-C6) alkenil ili supstituirani (C1-C6) alkinil) ili izoster amidne veze (na primjer, -CH2NH—, —CH2S, —CH2CH2-, —CH═CH— (cis i trans), —C (O) CH2-, —CH (OH) CH2-, ili —CH2SO—).

Spoj se može kovalentno povezati, na primjer, polimerizacijom ili konjugacijom, kako bi nastali homopolimeri ili heteropolimeri. Mogu se koristiti razmaknice i povezivači, obično sastavljeni od malih neutralnih molekula, poput aminokiselina koje su nenabijene u fiziološkim uvjetima. Veze se mogu ostvariti na više načina. Na primjer, ostaci cisteina mogu se dodati na krajevima peptida, a više peptida može biti kovalentno vezano kontroliranom oksidacijom. Alternativno, mogu se koristiti heterobifunkcionalni agensi, kao što su agensi za formiranje disulfida/amida ili tioeter/amidi. Spoj se također može ograničiti, na primjer, tako što ima ciklične dijelove.

U nekim izvedbama, trodimenzionalne tehnike molekularnog modeliranja mogu se koristiti za identifikaciju ili stvaranje spojeva koji mogu biti korisni kao terapija ili dijagnostika. Mogu se koristiti standardni alati za molekularno modeliranje, na primjer, oni opisani u L-H Hung i R. Samudrala, PROTINFO: predviđanje sekundarne i tercijarne strukture proteina, Nucleic Acids Research, 2003, Vol. 31, br. 13 3296-3299 A. Yamaguchi, et al. , Povećana FAMSBASE: 3D proteinski modeli strukture genomskih sekvenci za 41 vrstu, Istraživanje nukleinskih kiselina, 2003, Vol. 31, br. 1 463-468 J. Chen, et al., MMDB: Entrezova baza podataka 3D strukture, Nucleic Acids Research, 2003, Vol. 31, br. 1 474-477 R. A. Chiang, et al., Baza podataka o superpoziciji strukture, Istraživanje nukleinskih kiselina, 2003, Vol. 31, br. 1 505-510.

Peptidi ili peptidni analozi mogu se sintetizirati standardnim kemijskim tehnikama, na primjer, automatiziranom sintezom pomoću otopine ili metodologije sinteze u čvrstoj fazi. Automatski sintetizatori peptida su komercijalno dostupni i koriste tehnike dobro poznate u tehnici. Peptidi i analozi peptida mogu se također pripremiti korištenjem tehnologije rekombinantne DNK koristeći standardne metode, poput onih opisanih u, na primjer, Sambrook i dr. (Molekularno kloniranje: Laboratorijski priručnik. 2. sund., Izd., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbour, NY, 1989.) ili Ausubel et al. (Trenutni protokoli u molekularnoj biologiji, John Wiley & amp Sons, 1994).

Spojevi, poput peptida (ili njihovih analoga) mogu se identificirati rutinskim eksperimentima, na primjer, modificiranjem ostataka unutar SARS peptida uvođenjem jednostrukih ili više zamjena aminokiselina, brisanjem ili umetanjem, te identifikacijom onih spojeva koji zadržavaju biološku aktivnost, npr. oni spojevi koji imaju citotoksične sposobnosti.

Općenito, spojevi kandidati za prevenciju ili liječenje poremećaja posredovanih virusom SARS-a identificirani su iz velikih biblioteka prirodnih proizvoda ili sintetičkih (ili polusintetičkih) ekstrakata ili kemijskih biblioteka prema metodama poznatim u struci. Kandidati ili ispitivana jedinjenja mogu uključivati, bez ograničenja, peptide, polipeptide, sintetizovane organske molekule, organske molekule u prirodi i molekule nukleinske kiseline. U nekim izvedbama, takvi spojevi provjeravaju sposobnost inhibiranja replikacije ili patogenosti virusa SARS -a, uz održavanje sposobnosti zaražene ćelije da raste ili preživi.

Oni koji su vješti u području otkrivanja i razvoja lijekova shvatit će da precizan izvor ekstrakata ili spojeva za testiranje nije kritičan za postupak (metode) pronalaska. U skladu s tim, gotovo bilo koji broj kemijskih ekstrakata ili spojeva može se pregledati primjerenim ovdje opisanim metodama ili standardnim metodama. Primjeri takvih ekstrakata ili spojeva uključuju, ali nisu ograničeni na, biljne, gljivične, prokariotske ili životinjske ekstrakte, fermentacijske čorbe i sintetičke spojeve, kao i modifikaciju postojećih spojeva. Dostupne su i brojne metode za generiranje nasumične ili usmjerene sinteze (npr. Polusinteza ili potpuna sinteza) bilo kojeg broja kemijskih spojeva, uključujući, ali bez ograničenja, spojeve na bazi saharida, lipida, peptida i nukleinskih kiselina . Biblioteke sintetičkih spojeva komercijalno su dostupne. Alternativno, biblioteke prirodnih spojeva u obliku ekstrakata bakterija, gljivica, biljaka i životinja komercijalno su dostupne iz više izvora, uključujući Biotics (Sussex, UK), Xenova (Slough, UK), Harbour Branch Oceanographic Institute (Ft. Pierce, Florida) i PharmaMar, SAD (Cambridge, Massachusetts). Osim toga, prirodne i sintetički proizvedene biblioteke, na primjer, polipeptida virusa SARS koje sadrže vodeće sekvence, po želji se proizvode prema metodama poznatim u struci, na primjer, standardnim metodama ekstrakcije i frakcioniranja. Nadalje, ako se želi, bilo koja biblioteka ili spoj lako se mijenja standardnim kemijskim, fizičkim ili biokemijskim metodama.

Kada se utvrdi da sirovi ekstrakt modulira citotoksičnost ili virusnu infekciju, potrebno je daljnje frakcioniranje pozitivnog ekstrakta olova kako bi se izolirali kemijski sastojci odgovorni za uočeni učinak. Stoga je cilj procesa ekstrakcije, frakcioniranja i pročišćavanja pažljiva karakterizacija i identifikacija kemijskog entiteta u sirovom ekstraktu koji ima, na primjer, antitocitotoksičnost ili antivirusna svojstva. Isti ovdje opisani testovi za otkrivanje aktivnosti u mješavinama spojeva mogu se koristiti za pročišćavanje aktivne komponente i za ispitivanje njenih derivata. Metode frakcionisanja i prečišćavanja takvih heterogenih ekstrakata poznate su u struci. Po želji, spojevi za koje se pokazalo da su korisna sredstva za liječenje kemijski su modificirani prema metodama poznatim u struci. Spojevi za koje se utvrdi da imaju terapeutsku, profilaktičku, dijagnostičku ili drugu vrijednost u, na primjer, sistemima stanične kulture, kao što je sistem kulture Vero E6, mogu se naknadno analizirati pomoću životinjskog modela tvora ili bilo kojeg drugog životinjskog modela pogodnog za analizu SARS -a.

Spojevi izuma mogu se koristiti za pripremu antitijela na peptide virusa SARS -a, proteine, poliproteine ​​ili njihove analoge ili na molekule nukleinske kiseline virusa SARS -a ili njihove analoge koristeći standardne tehnike pripreme, na primjer, opisane u Harlow i Lane ( Antitijela Laboratorijski priručnik, Laboratorija Cold Spring Harbor, Cold Spring Harbor, NY, 1988.) ili poznata stručnjacima u ovoj oblasti. Antitela mogu uključivati ​​poliklonska antitela, monoklonska antitela, hibridna antitela (npr. Dvovalentna antitela koja imaju različite parove teških i lakih lanaca), himerna antitela (npr. Antitela koja imaju stalne i promenljive domene iz različitih vrsta i/ili klasa), modifikovana antitela (npr. , antitijela u kojima je prirodna sekvenca promijenjena, na primjer, rekombinantnim tehnikama), Fab antitijela, anti-idiotipna antitijela itd. Antitijela se mogu skrojiti da minimiziraju imunološki odgovor domaćina, na primjer, upotrebom himernih antitijela koja sadrže vezanje antigena domenu iz jedne vrste i Fc dio iz druge vrste, ili upotrebom antitijela napravljenih od hibridoma odgovarajuće vrste. Na primjer, "humanizirana" antitijela mogu se koristiti za primjenu na ljudima.

Za stvaranje antitela specifičnih za polipeptide SARS virusa, kodirajuća sekvenca polipeptida virusa SARS može se izraziti, na primjer, kao fuzija C-terminala s glutation S-transferazom (GST) (Smith i sur., Gene 67: 31-40, 1988 ). Fuzijski polipeptid se tada može pročistiti na zrncima glutation-sefaroza, eluirati s glutationom cijepljenim trombinom (na projektiranom mjestu cijepanja) i pročistiti do stupnja neophodnog za imunizaciju kunića. Primarne imunizacije provode se s Freudovim potpunim adjuvantom, a kasnije imunizacija s Freudovim nepotpunim adjuvansom. Titri antitijela se prate Western blot i imunoprecipitacionom analizom korištenjem trombinsko cijepljenog SARS virusa fragmenta fuzijskog polipeptida virusa GST-SARS. Imunski serumi se pročišćavaju afinitetom pomoću polipeptida SARS virusa povezanog sa CNBr-sefarozom. Specifičnost antiseruma određuje se pomoću panela nepovezanih GST polipeptida.

Kao zamjenski ili pomoćni imunogen za fuzijske polipeptide GST-a, peptidi koji odgovaraju relativno jedinstvenim polipeptidima hidrofilnog virusa SARS-a mogu se generirati i spojiti s hemocijaninom u ključaonici (KLH) kroz uvedeni C-terminalni lizin. Antiserum za svaki od ovih peptida ima sličan afinitet pročišćen na peptidima konjugiranim na BSA, a specifičnost je ispitana u ELISA -i i Western blotovima korištenjem peptidnih konjugata, te Western blot -om i imunoprecipitacijom pomoću polipeptida virusa SARS izraženog kao GST fuzijski polipeptid.

Alternativno, monoklonska antitijela mogu se pripremiti korištenjem gore navedenih polipeptida virusa SARS i standardne tehnologije hibridoma (vidi, npr., Kohler et al., Nature, 256: 495, 1975 Kohler et al., Eur. J Immunol. 6: 511, 1976 Kohler et al., Eur. Nakon što se proizvedu, monoklonska antitijela se također testiraju na prepoznavanje specifičnih polipeptida SARS virusa Western blotom ili imunoprecipitacionom analizom (metodama opisanim u Ausubel et al., Gore). Antitijela koja specifično prepoznaju polipeptide virusa SARS -a smatraju se korisnima u izumu, takva se antitijela mogu koristiti, npr. U imunološkom testu za praćenje nivoa polipeptida virusa SARS -a koje proizvodi sisavac (na primjer, za određivanje količine ili lokacije Polipeptid virusa SARS).

U alternativnoj izvedbi, antitijela iz izuma ne proizvode se samo korištenjem cijelog polipeptida virusa SARS -a, već se koriste fragmenti polipeptida virusa SARS -a koji su jedinstveni ili koji leže izvan visoko konzerviranih regija i čini se da će biti antigeni, prema kriterijima poput visokog može se koristiti i učestalost nabijenih ostataka. U jednom specifičnom primjeru, takvi se fragmenti generiraju standardnim tehnikama PCR -a i kloniraju u pGEX ekspresijski vektor (Ausubel et al., Gore). Fuzijski polipeptidi su eksprimirani u E. coli i pročišćen korištenjem matrice afiniteta prema glutation -agarozi kako je opisano u Ausubel et al. (gore). Kako bi se pokušali umanjiti potencijalni problemi niskog afiniteta ili specifičnosti antiseruma, generiraju se dvije ili tri takve fuzije za svaki polipeptid, a svaka fuzija se injektira u najmanje dva kunića. Antiserumi se podižu injekcijama u seriji, po mogućnosti uključujući najmanje tri pojačane injekcije. Antitijela na virus SARS mogu se pripremiti i protiv molekula nukleinske kiseline virusa SARS.

Antitijela se mogu koristiti kao dijagnostika, terapija ili profilaksa za poremećaje povezane sa virusom SARS. Antitijela se također mogu koristiti za izolaciju virusa i spojeva SARS -a, na primjer, afinitetnom hromatografijom, ili za identifikaciju spojeva virusa SARS -a izoliranih ili nastalih drugim tehnikama.

U nekim aspektima, biološki testovi, kao što su dijagnostički ili drugi testovi, koji koriste nukleinske kiseline, polipeptide ili nizove antitijela velike gustoće, na primjer minijaturizirani nizovi ili „mikroredovi“ velike gustoće, molekula nukleinske kiseline ili polipeptida virusa SARS, ili antitijela sposobna može se izvesti specifično vezivanje takvih molekula ili polipeptida nukleinske kiseline. Mogu se koristiti i makrocrti, izvedeni, na primjer, ručnim tehnikama uočavanja. Nizovi općenito zahtijevaju čvrstu podlogu (na primjer, najlonske, staklene, keramičke, plastične, silicijske, nitrocelulozne ili PVDF membrane, mikro udubine, mikro kuglice, npr. Magnetske mikro kuglice itd.) Na koje su vezane molekule nukleinske kiseline ili polipeptidi ili antitijela određeni dvodimenzionalni raspored, tako da se obrazac hibridizacije može lako odrediti. Također se mogu koristiti nizovi ovjesa (čestice u suspenziji) koji su kodirani radi lakše identifikacije. Molekule nukleinske kiseline virusa SARS ili polipeptidne sonde ili mete mogu biti spojevi kako je ovdje opisano.

U nekim izvedbama, nizovi nukleinskih kiselina velike gustoće mogu se, na primjer, koristiti za praćenje prisutnosti ili razine ekspresije velikog broja molekula ili gena nukleinske kiseline virusa SARS ili za otkrivanje ili identifikaciju varijacija, mutacija ili polimorfizama sekvence nukleinske kiseline virusa SARS. U svrhu takvih nizova, "nukleinske kiseline" mogu uključivati ​​bilo koji polimer ili oligomer nukleozida ili nukleotida (polinukleotidi ili oligonukleotidi), koji uključuju pirimidinske i purinske baze, po mogućnosti citozin, timin i uracil, odnosno adenin i gvanin, ili može uključivati ​​peptidne nukleinske kiseline (PNA). U alternativnom aspektu, izum pruža mikro nizove nukleinskih kiselina koji uključuju niz različitih nizova sekvenci nukleinske kiseline izuma, dajući na taj način specifične "skupove" sekvenci. Broj različitih nizova može, na primjer, biti bilo koji cijeli broj između 2 i 1 × 10 5, kao što je najmanje 10 2, 10 3, 10 4 ili 10 5.

Izum također pruža biblioteke nokauta i ekspresije gena.Tako se molekule nukleinskih kiselina koje kodiraju polipeptide ili proteine ​​virusa SARS (npr. PCR produkti ORF-a ili ukupne mRNA) mogu, na primjer, vezati na čvrstu podlogu, hibridiziranu s jednolančanim detektirano obilježenim cDNA (što odgovara "antisensnoj" orijentaciji), i kvantificiran primjenom odgovarajuće metode tako da se signal detektira na svakoj lokaciji na kojoj je došlo do hibridizacije. Intenzitet signala bi tada odražavao nivo ekspresije gena. Poređenje rezultata virusa, na primjer, različitih sojeva ili različitih uzoraka ili subjekata, razjasnilo bi različite nivoe ekspresije navedenih gena. Koristeći slične tehnike, homologne nukleinske kiseline mogu se identificirati iz različitih virusa ako se nukleinske kiseline virusa SARS -a koriste u mikroredu i testiraju molekulama nukleinskih kiselina iz različitih virusa ili subjekata. U nekim izvedbama, ovaj pristup može uključivati ​​konstrukciju njegovih označenih biblioteka ekspresije ORP virusnih genoma u bakterijskom domaćinu, slično biblioteci ekspresije u kvascu (Martzen M. R. i sur., 1999. Science, 286: 1153). Proteinske aktivnosti kodirane ORF-om mogu se, na primjer, otkriti u pročišćenim proteinima obilježenim njegovim oznakama u slučajevima kada se aktivnosti ne mogu otkriti u ekstraktima ili stanicama. U jednom aspektu pronalaska, biblioteke u nizu mogu biti izgrađene od virusnih sojeva od kojih svaki nosi plazmid koji eksprimira različit ORF virus SARS -a pod kontrolom inducibilnog promotora. ORF-i su amplificirani pomoću PCR-a i klonirani u vektor koji omogućava njihovu ekspresiju kao N-terminalni polipeptidi označeni his-oznakom. Ovi se amplikoni također koriste za konstrukciju hibridizacijskih mikroredova i omogućuju ciljano ometanje gena, smanjujući troškove. Odabran je odgovarajući domaćin ekspresije, a geni koji kodiraju određene biokemijske aktivnosti identificiraju se skriningom raspoređenih bazena njegovih označenih proteina kako je prethodno opisano (Martzen MR, McCraith SM, Spinelli SL, Torres FM, Fields S., Grayhack EJ i Phizicky EM , 1999. Nauka, 286: 1153).

U nekim izvedbama, proteinski nizovi (uključujući antitijela ili nizove antigena) mogu se koristiti za analizu i identifikaciju polipeptida virusa SARS -a ili odgovora domaćina na takve polipeptide. Tako se proteinski nizovi mogu koristiti za otkrivanje polipeptida virusa SARS -a kod pacijenata koji razlikuju polipeptid virusa SARS -a od polipeptida domaćina za otkrivanje interakcija između polipeptida virusa SARS -a, a na primjer proteini domaćini određuju učinkovitost potencijalnih terapeutika, kao što su male molekule ili ligandi koji mogu vezujući polipeptidi virusa SARS određuju interakcije protein-antitijelo i/ili otkrivaju interakciju interakcija enzim-supstrat. Proteinski nizovi se također mogu koristiti za otkrivanje antigena i antitijela virusa SARS -a u uzorcima radi profiliranja ekspresije polipeptida virusa SARS -a radi identifikacije odgovarajućih antitijela ili mapiranja epitopa ili za razne analize funkcija proteina.

Poznati su različiti postupci za izradu i upotrebu mikrocrtova, kao što je na primjer otkriveno u Cheung VG, et al., 1999. Nature Genetics Supplement, 21: 15-19 Lipshutz RJ, et al., 1999. Nature Genetics Supplement, 21: 20-24 Bowtell DDL, 1999. Nature Genetics Supplement, 21: 25-32 Singh-Gasson S., et al., 1999. Nature Biotechnol., 17: 974-978 i Schweitzer B., et al., 2002. Nature Biotechnol., 20: 359-365. Tako se, na primjer, mikro nizovi mogu dizajnirati sintezom oligonukleotida sa varijacijama sekvenci na osnovu referentnih sekvenci, kao što su ovdje opisane bilo koje sekvence virusa SARS -a. Metode za pohranjivanje, postavljanje upita i analizu podataka o mikročipovima su, na primjer, otkrivene u, na primjer, američkim patentima br. 6,484,183 US Pat. No. Br. 6,188,783 i Holloway A. J., et al., 2002. Nature Genetics Supplement, 32: 481-489. Proteinski nizovi se mogu konstruirati, detektovati i analizirati metodama poznatim u tehnici, na primjer tehnikama spektrometrije mase, imunološkim testovima kao što je ELISA i Western (tačkasto) blotiranje u kombinaciji s, na primjer, tehnikama detekcije fluorescencije, te prilagoditi za analizu velike propusnosti, kako je opisano u na primjer MacBeath, G. i Schreiber, SL Science 2000, 289, 1760-1763 Levit-Binnun N, et al. (2003) Kvantitativno otkrivanje proteinskih nizova. Anal Chem 75: 1436-41 Kukar T, et al. (2002) Proteinski mikroredovi za otkrivanje interakcija proteina i proteina pomoću crvenih i zelenih fluorescentnih proteina. Anal Biochem 306: 50-4 Borrebaeck C A, et al. (2001) Proteinski čips na bazi -rekombinantnih fragmenata antitijela: visoko osjetljiv pristup otkriven masenom spektrometrijom. Biotechniques 30: 1126-1132 Huang R P (2001) Detekcija više proteina u sistemu proteinskih mikromreža zasnovanih na antitijelima. J Immunol Methods 255: 1-13 Emili A Q i Cagney G (2000) Velike funkcionalne analize pomoću peptidnih ili proteinskih nizova. Nature Biotechnol 18: 393-397 Zhu H, et al. (2000) Analiza proteinskih kinaza kvasca pomoću proteinskih čipova. Nature Genet 26: 283-9 Lueking A, et al. (1999) Proteinski mikročipovi za ekspresiju gena i skrining antitijela. Anal. Biochem. 270: 103-111 ili Templin M F, et al. (2002) Tehnologija proteinskih mikročipova. Drug Discov Today 7: 815-822. Alati za tehnike mikromreža dostupni su na tržištu iz, na primjer, Affymetrix, Santa Clara, Kalifornija, Nanogen, San Diego, Kalifornija ili Sequenom, San Diego, Kalifornija.

Računalno čitljivi zapisi

Sekvence nukleinske kiseline i polipeptida, kako su ovdje opisane, ili njihov fragment, mogu se dati u različitim medijima kako bi se olakšao pristup tim sekvencama i omogućila njihova upotreba. Prema tome, nukleinske kiseline i polipeptidne sekvence virusa SARS -a iz ovog izuma mogu se snimiti ili pohraniti na kompjuterski čitljivom mediju, koristeći bilo koju tehniku ​​i format koji je prikladan za određeni medij.

U alternativnim ostvarenjima, izum pruža kompjuterski čitljive medije kodirane sa nizom različitih nizova podataka nukleinske kiseline ili aminokiselina iz ovog pronalaska. Broj različitih nizova može, na primjer, biti bilo koji cijeli broj između 2 i 1 × 10 5, kao što je najmanje 10 2, 10 3, 10 4 ili 10 5. U jednoj izvedbi, pronalazak sadrži računarski medij koji ima mnoštvo digitalno kodiranih zapisa podataka. Svaki zapis podataka može uključivati ​​vrijednost koja predstavlja nukleinsku kiselinu ili aminokiselinsku sekvencu izuma. U nekim izvedbama, zapis podataka može dalje uključivati ​​vrijednosti koje predstavljaju nivo ekspresije, nivo ili aktivnost nukleinske kiseline ili aminokiselinske sekvence izuma. Zapis podataka može biti strukturiran kao tablica, na primjer, tablica koja je dio baze podataka, kao što je relacijska baza podataka (na primjer, SQL baza podataka okruženja baze podataka Oracle ili Sybase). Pronalazak takođe uključuje metodu prenošenja informacija o uzorku, na primjer prenosom informacija, na primjer prenošenjem računarski čitljivog zapisa, kao što je ovdje opisano, na primjer putem računarske mreže. Polipeptidnim i nukleinskim kiselinskim sekvencama iz izuma, kao i informacije o sekvencama koje se na to odnose, mogu biti rutinski pristupačne od strane prosječnog stručnjaka u razne svrhe, uključujući i za potrebe upoređivanja suštinski identičnih sekvenci itd. Takav pristup može biti omogućeno korišćenjem javno dostupnog softvera kako je ovde opisano. Pod "računarski čitljivim medijem" podrazumijeva se svaki medij kojem računar može čitati i direktno pristupiti. Takvi mediji uključuju, ali nisu ograničeni na: magnetske medije za pohranu, kao što su diskete, medij za pohranu tvrdih diskova i optičke medije za pohranu magnetske trake, kao što su CD-ROM električni mediji za pohranu, poput RAM-a i ROM-a, te hibridi ovih kategorija, kao što su magnetski/optički medij za pohranu.

Farmaceutski i veterinarski sastavi, doze i administracija

Spojevi izuma mogu se dati sami ili u kombinaciji s drugim spojevima (na primjer, male molekule, peptidi ili analozi peptida), u prisutnosti liposoma, adjuvansa ili bilo kojeg farmaceutski prihvatljivog nosača, u obliku pogodnom za primjenu ljudima ili životinjama.

Uobičajena farmaceutska praksa može se primijeniti za osiguravanje odgovarajućih formulacija ili sastava za primjenu spojeva kod pacijenata koji pate od SARS -a ili su presimptomatski. Može se primijeniti bilo koji odgovarajući način davanja, na primjer, parenteralna, intravenozna, potkožna, intramuskularna, intrakranijalna, intraorbitalna, oftalmološka, ​​intraventrikularna, intrakapsularna, intraspinalna, intracisternalna, intraperitonealna, intranazalna, aerosolna ili oralna primjena. U nekim izvedbama, spojevi se isporučuju direktno u pluća, na primjer, formulacijama pogodnim za inhalaciju. U nekim izvedbama, tehnike genske terapije mogu se koristiti za primjenu molekula nukleinske kiseline virusa SARS, na primjer, kao DNA vakcine. Formacije mogu biti u obliku tekućih otopina ili suspenzija za oralnu primjenu, formulacije mogu biti u obliku tableta ili kapsule i za intranazalne formulacije, u obliku praha, kapi za nos ili aerosola.

Metode dobro poznate u tehnici za izradu formulacija nalaze se u, na primjer, “Remington's Pharmaceutical Sciences” (18. izdanje), ed. A. Gennaro, 1990, Mack Publishing Company, Easton, Pa. Formulacije za parenteralnu primjenu mogu, na primjer, sadržavati pomoćne tvari, sterilnu vodu ili fiziološku otopinu, polialkilen glikole, poput polietilen glikola, ulja biljnog porijekla ili hidrogenirane naftalene. Biokompatibilni, biorazgradivi laktidni polimer, kopolimer laktid/glikolid ili polioksietilen-polioksipropilenski kopolimeri mogu se koristiti za kontrolu otpuštanja spojeva. Drugi potencijalno korisni sistemi za parenteralnu primjenu moduliranih spojeva uključuju etilen-vinil acetat kopolimerne čestice, osmotske pumpe, implantacijske sisteme za infuziju i liposome. Formulacije za inhalaciju mogu sadržavati pomoćne tvari, na primjer, laktozu, ili mogu biti vodene otopine koje sadrže, na primjer, polioksietilen-9-lauril eter, glikoholat i deoksiholat, ili mogu biti uljne otopine za primjenu u obliku kapi za nos, ili kao gel.

Po želji, liječenje spojem prema izumu može se kombinirati s tradicionalnijim terapijama za bolest.

Za terapijske ili profilaktičke pripravke, spojevi se daju pojedincu u količini dovoljnoj za zaustavljanje ili usporavanje replikacije virusa SARS -a ili za pružanje zaštitnog imuniteta protiv buduće infekcije virusom SARS -a. Količine koje se smatraju dovoljnima varirat će ovisno o specifičnom spoju koji se koristi, načinu primjene, stadiju i ozbiljnosti bolesti, dobi, spolu i zdravlju pojedinca koji se liječi, te istovremenim tretmanima. Kao opće pravilo, međutim, doze se mogu kretati od oko 1 μg do oko 100 mg po kg tjelesne težine pacijenta za početnu dozu, s naknadnim prilagođavanjem ovisno o pacijentovom odgovoru, što se može izmjeriti, na primjer utvrđivanjem prisutnosti molekula nukleinske kiseline SARS -a, polipeptida ili viriona u perifernoj krvi pacijenta.

U slučaju formulacija cjepiva, imunogeno efikasna količina spoja prema izumu može se dati, sama ili u kombinaciji s drugim spojevima, s adjuvansom, na primjer, Freundovim nepotpunim adjuvansom ili aluminijevim hidroksidom. Spoj se također može povezati s molekulom nosiocem, poput goveđeg serumskog albumina ili hemocijanina u ključaonici kako bi se povećala imunogenost. Općenito, spojeve iz izuma treba koristiti bez izazivanja značajne toksičnosti. Toksičnost spojeva prema izumu može se odrediti korištenjem standardnih tehnika, na primjer, testiranjem na staničnim kulturama ili pokusnim životinjama i određivanjem terapijskog indeksa, odnosno omjera između LD50 (doza smrtonosna na 50% populacije) i LD100 (doza smrtonosna za 100% populacije). U nekim okolnostima, na primjer, u teškim oboljenjima, može biti potrebno primijeniti značajne viškove kompozicija.

Izolacija virusa izvedena je na uzorku bronhoaveolarne lavaže smrtonosnog slučaja SARS -a koji pripada izvornoj grupi slučajeva iz Toronta, Kanada. Sav rad sa uzročnikom infekcije obavljao se u laboratoriji za biološku sigurnost 3 (BSL3) koristeći masku N100 za ličnu zaštitu. Uzorci su uklonjeni iz BSL3 nakon dodavanja pufera za ekstrakciju RNA. Izolat virusa, nazvan "Tor2 izolat" uzgajan je u stanicama bubrega afričkog zelenog majmuna (Vero E6), virusne čestice su pročišćene, a genetski materijal (RNA) je ekstrahiran iz izolata Tor2 (Poutanen, SM et al., N Engl J Med, 10. aprila 2003.). Preciznije, sto mikrolitarskih uzoraka korišteno je za inokulaciju Vero E6 ćelija (ATCC CRL 1586) na Dulbeccovom modificiranom mediju za orlove, dopunjenom penicilinom/streptomicinom, glutaminom i 2% fetalnog telećeg seruma. Kultura je inkubirana na 37 ° C. Citopatogeni učinak primijećen je 5 dana nakon inokulacije. Virus je pasiran u novo zasijane ćelije Vero E6 koje su pokazale citopatogeni učinak već 2 dana nakon infekcije (višestrukost infekcije 10-2). Izvor virusa pripremljen je iz prolaza 2 ovih ćelija i konzerviran u tekućem dušiku. Utvrđeno je da je titar zalihe virusa 1 × 10 7 jedinica koje stvaraju plak (p.f.u.) testom plaka i 5 × 10 6 infektivnom dozom kulture tkiva (TCID) 50.

Za širenje virusa, 10 × T-162 tikvice Vero E6 ćelija inficirane su s višestrukom infekcijom od 10 -2. Kada su inficirane stanice pokazale citopatogeni učinak '4+' (48 sati nakon infekcije), kulture su zatim zamrznute i odmrznute kako bi lizirale ćelije, a supernatanti su pročišćeni iz krhotina stanica centrifugiranjem pri 10.000 o / min Beckmanovom velikom brzinom centrifuga. Supernatanti su tretirani s DNAzom i RNAzom 3 sata na 37 ° C kako bi se uklonila bilo koja stanična genomska nukleinska kiselina i zatim ekstrahirani s jednakim volumenom 1,1,2-trikloro-trifluoroetana. Gornja frakcija je ultra-centrifugirana kroz gradijent koraka od 5%/40% glicerola na 151,000 × g 1 sat na 4 ° C. Pelet virusa je resuspendiran u PBS-u. RNA je izolirana pomoću komercijalnog kompleta iz QIAGENA i pohranjena na -80 ° C za daljnju upotrebu.

Izgradnja biblioteke cDNA

RNA i kasniji proizvodi su rukovani pod uslovima biološke bezbednosti 2 (BSL2). Uzorak RNK je konvertovan u biblioteku cDNA, koristeći kombinovanu strategiju nanošenja nasumičnog prajmera i oligo-dT, a rezultujući subgenomski klonovi su obrađeni u uslovima biološke bezbednosti nivoa 1. Preciznije, pročišćena virusna RNA (55 ng) je korištena u izgradnji biblioteke cDNA sa nasumičnim punjenjem i oligo-dT primiranim, koristeći SuperScript Choice System za sintezu cDNA (Invitrogen). Linkeri 5′-AATTCGCGGCCGCGTCGAC-3 ′, SEQ ID NO: 195 i 5′-pGTCGACGCGGCCGCG-3 ′, SEQ ID NO: 196, bili su podvezani nakon sinteze cDNA. Proizvodi sinteze cDNA vizualizirani su na agaroznim gelovima, otkrivajući očekivani razmaz niskog prinosa. Da bi se proizvelo dovoljno cDNA za kloniranje, proizvod cDNA je frakcioniran veličinom na preparativnom agaroznom gelu sa niskom tačkom topljenja, nakon čega je uslijedila PCR amplifikacija pomoću jednog PCR prajmera 5′AATTCGCGGCCGCGTCGAC-3 ′, SEQ ID NO: 197, specifičnog za linkere. Time je dobiveno dovoljno materijala za kloniranje.

Proizvodi cDNA odabrane veličine su klonirani i generirani su pojedinačni očitci sekvenci sa svakog kraja umetka iz nasumično odabranih klonova. Popis klonova virusa SARS-a nalazi se u pratećem popisu sekvenci, koji je ovdje uključen referencom (SEQ ID NO: 92-159, 208 i 209).

Preciznije, cDNA odabrane veličine su ligirane u pCR4-TOPO TA klonirajući vektor (Invitrogen, CA), ili nakon digestije sa restrikcionom nukleazom Not I u vektor pBR194c (Institut za genomska istraživanja, Rockville, Md, SAD) . Ligirani klonovi su zatim transformirani elektroporacijom u DH10B T1 ćelije (Invitrogen), stavljene na agar ploče od 22 cm s odgovarajućim antibiotikom i uzgajane 16 sati na 37 ° C. Kolonije su ubrane u blokove kisikove kulture s 384 jažica koji sadrže 2 × YT medij i uzgajane u inkubatoru koji se trese 18 sati na 37 ° C. Ćelije su lizirane i DNK pročišćena standardnim laboratorijskim postupcima. Prajmeri za sekvenciranje za klonove 194c bili su 5′-GGCCTCTTCGCTATTACGC-3 ′ (prednji prajmer) (SEQ ID NO: 159) i 5 ′ TGCAGGTCGACTCTAGAGGAT-3 ′ (obrnuti prajmer) (SEQ ID NO: 198).

DNK sekvenciranje i sastavljanje očitanja

Skupovi su sastavljeni i sklop je uređen kako bi se proizvela genomska sekvenca virusa SARS. Preciznije, DNK sekvenciranje oba kraja šablona plazmida postignuto je upotrebom terminatorskog reagensa Applied Biosystems BigDye (verzija 3), uz elektroforezu i prikupljanje podataka na instrumentima AB 3700 i 3730 XL. Očitavanja DNK sekvence su pregledana na sekvence kontaminirane virusom, obrezane. za kvalitetu koristeći PHRED (Ewing, B i P. Green, Genome Res 8, 186-94, mart 1998.) i sastavljeni pomoću PHRAP-a (Gordon, D. i sar. Genome Res 8, 195-202, mart, 1998). Istovremeno, sekvence su korištene u BLAST pretragama virusnih nukleotidnih i ne-redundantnih skupova proteina (NCBI, Nacionalna medicinska biblioteka) za traženje sličnosti. Skupovi sekvenci vizualizirani su pomoću CONSED -a (Gordon, D. i sur. Genome Res 8, 195-202, mart, 1998). Pogrešni sklopovi sekvence i spojevi povezani su identificirani pomoću Miropeats-a (Parsons, J. D., Comput Appl Biosci 11, 615-9 (decembar, 1995.). Kako su se prikupljali podaci o sekvencama, dodatne sekvence su se sastavljale sve dok nije postalo očito da dodatna dubina uzorkovanja povećava dubinu pokrivanja, ali ne produžava dužinu kontiga. U ovom trenutku generirano je 3.080 čitanja sekvenciranja, od kojih je 2.634 sastavljeno u jedan veliki niz.

Podaci o redoslijedu uvezeni su u bazu podataka ACEDB (Durbin, J. Thierry-Mieg, 1991. Baza podataka C. elegans. Dokumentacija, kôd i podaci dostupni sa anonimnih FTP servera na lirmm „tačka“ lirmm „tačka“ sa cele „tačke“ mrc-1mb "dot" cam "dot" ac "dot" uk i ncbi "dot" n1m "dot" nih "dot" gov) i podvrgnuti biološkoj analizi, uključujući identifikaciju otvorenih okvira čitanja, otkrivanje sličnih sekvenci pomoću BLAST-a i u potrazi za očiglednim pomacima okvira. Kada su ovom analizom identificirani pomaci okvira, konsultovan je niz sekvenci radi dokaza o greškama u sekvenciranju i ako su pronađeni, ispravljeni su. Sekvence su također tražene za bilo koje koje bi mogle produžiti 5 'kraj sekvence i one su uključene kada su pronađene. Identifikovane su i otklonjene razlike u kvalitetu sekvenci između različitih očitavanja sekvenci. Očitavanja redoslijeda klasificirana kao izbrisana ili himerna identificirana su ručnim pregledom i uklonjena iz sklopa. Rezultirajući niz ima prosječnu ocjenu kvaliteta postignutu konsenzusom PHRED -a od 89,96. Najniže kvalitete baze u sklopu su u neposrednoj blizini 5 'i 3' krajeva virusnog genoma, a najniža kvaliteta ima PHRED skor 35. Većina (29.694 od 29.736 (99,86%)) od baze imaju konsenzusnu ocjenu 90.Gotovo sve regije genoma predstavljene su očitavanjima izvedenim iz oba lanca šablona sekvenciranja plazmida, izuzetak su 50 baza na 5 ′ kraju predstavljenih jednim čitanjem sekvenciranja, i 5 baza na 3 ′ kraju predstavljenih jednim čitanjem . Prosječna baza u sklopu je predstavljena sa 30 očitavanja u smjeru naprijed i 30 očitavanja u obrnutom smjeru, kako je utvrđeno PHRED -om. RT-PCR proizvodi predviđeni sekvencom i obuhvataju čitav genom daju PCR proizvode predviđene veličine na agaroznim gelovima. Kako bi se potvrdio 5 ′ kraj virusnog genoma, RACE je izveden korištenjem kompleta RLM-RACE iz Ambiona i prajmera 5′-CAGGAAACAGCTATGACACCAAGAACAAGGCTCTCCA-3 ′ (SEQ ID NO: 90) i 5′-CAGGAAACAGCTATGACGGCCTCTTCACAC (3) : 91). Četrnaest klonova je pronađeno i sekvencirano. Analiza ovih sekvenci potvrdila je 5 ′ kraj genoma koronavirusa. Genomske sekvence SARS -a deponovane su u Genbank (pristupni brojevi AY274119.1, AY274119.2 i AY274119.3).

Iako je izum opisan u vezi s njegovim specifičnim ostvarenjima, podrazumijeva se da je sposoban za daljnje izmjene i da je ova aplikacija namijenjena da obuhvati sve varijacije, upotrebe ili adaptacije izuma slijedeći, općenito, načela pronalaska i uključujući takva odstupanja od ovog otkrića koja potpadaju pod poznatu ili uobičajenu praksu u oblasti tehnike na koju se pronalazak odnosi, a mogu se primijeniti na bitne karakteristike navedene ovdje i u obimu dodanih zahtjeva.

Svi patenti, prijave patenta i publikacije na koje se ovdje poziva uključeni su u cijelosti kao referenca u istoj mjeri kao da je svaki pojedinačni patent, prijava patenta ili publikacija posebno i pojedinačno naznačeno da se u cijelosti uključuje kao referenca.


Kristalizacija metalnih nanočestica na kratkim DNK oligonukleotidima u alkalnoj vodenoj otopini

Nanočestice srebra, cinka i bakra su redukciono kristalizovane na jednolančanoj DNK dekanukleotidu koji sadrži timin, u vodenim rastvorima koji sadrže odgovarajuće metalne jone i natrijum borhidrid, na 4 ° C, pH 11,8 i 15 mM NaCl. Pod tim uvjetima nisu nastale nanočestice željeza. Formiranje agregata praćeno je UV-Vis spektrofotometrijom, a karakterizirano skenirajućom elektronskom mikroskopijom i dinamičkim rasipanjem svjetlosti. Apsorpcijski spektri za većinu uzoraka koji sadrže Ag + pokazali su veliki pojas centriran oko 425 nm i ramena između 500 i 600 nm, što ukazuje na prisutnost čestica srebra u širokoj distribuciji veličina, u rasponu od 0,1 do 5 μm. To je potvrđeno mikrografijom i raspodjelom veličine u profilima rasipanja. Morfologija čestica srebra ukazuje na formiranje kubičnih struktura umjesto sfernih geometrija. U slučaju nanočestica cinka i bakra, kvazi-sferne strukture od približno 100 nm kristalizirane su duž lanaca DNA redukcijskom reakcijom, a zatim oslobođene u otapalo. Ostaci timina pokazuju veću efikasnost u nukleaciji metalnih katjona u odnosu na druge DNK nukleobaze, posebno u njihovom deprotoniranom obliku, pri visokim pH vrijednostima. Adenini koji okružuju centralne nizove baza koje se deprotoniraju u modelu oligonukletidnog lanca utječu na proizvodnju kristala srebra na DNK dekamerima. pH vrijednost i koncentracija NaCl imaju značajan utjecaj na proizvodnju čestica srebra, jer su za kristalizaciju takvih struktura potrebni alkalni i umjereno ionski uvjeti. Podešavanje veličine i morfologije metalnih nanočestica pravilnim izborom oligonukleotidne sekvence i fizičkih uslova može imati zanimljive primjene u području nanobiotehnologije.

Ovo je pregled sadržaja pretplate, pristup putem vaše institucije.


Diskusija

Predloženo je da je CST kompleks specifičan za telomere RPA-sličan kompleks 12. Nedavne strukturne studije koje smo izvršili mi i druge grupe pokazale su blisku strukturnu sličnost između Stn1-Ten1 i RPA32-RPA14 22, 23. Iako je dostupna struktura otopine DN-vezujućeg OB nabora Cdc13, odnos između Cdc13 i RPA70 ostaje nejasan zbog nedostatka strukturnih informacija o drugim regijama Cdc13 i nedostatka sličnosti sekvenci između Cdc13 i RPA. U ovom radu naše bioinformatičke i strukturne analize pružaju prve izravne dokaze o postojanju višestrukih OB nabora u Cdc13, što je karakteristično za RPA70. Sličnost između Cdc13OB1-Pol1CBM i kompleksi RPA70N-p53 dodatno proširuju paralelu između Cdc13 i RPA70 (slika 4C i 4D). Međutim, unatoč tim sličnostima, postoje značajne razlike između Cdc13 i RPA70. Prvo, za razliku od Stn1-Ten1, nijedan od dva strukturno definirana OB nabora Cdc13 ne pokazuje sličnost sa svojim kolegama u RPA70 izvan središnjih jezgara β-cijevi (slika 2B) 25, 26. Drugo, dva centralna OB nabora RPA70 potrebna su za efikasno vezivanje DNK, dok Cdc13 koristi samo svoj OB3 za vezivanje 41. Ove izrazite razlike ukazuju na to da sličnost između Cdc13 i RPA70 može biti rezultat konvergentne evolucije. Drugim riječima, Cdc13 možda nije evoluirao iz predaka RPA70, već ih je umjesto toga angažirao kompleks Stn1-Ten1 kako bi osigurao jednolančanu aktivnost vezanja za DNA. U skladu s ovom idejom, otkrili smo da Candida spp. Cdc13 proteini sadrže samo dva OB nabora koji odgovaraju C-terminalnoj polovini Saccharomyces spp. proteini. Osim toga, nedavno identificirani proteini CTC1, najveće komponente u ljudskim i biljnim CST kompleksima, mnogo su veći proteini i nemaju sličnost u sekvenci ni sa Cdc13 ni sa RPA70, što podržava različito porijeklo ovih proteina 17, 18. Iako ne možemo isključiti mogućnost da je zajedničko podrijetlo ovih proteina zaklonjeno iznimno brzom evolucijskom divergencijom, čini se jasnim da su strukturni i funkcionalni odnosi između Cdc13/CTC1 i Stn1-Ten1 prilično različiti od onih između RPA70 i RPA32–14 .

Upečatljiv rezultat ove studije je da se čini da je homodimerizacija očuvana karakteristika Cdc13. Osim za CgCdc13, većina Saccharomyces i Kluyveromyces Proteini Cdc13 tvore dimer preko svojih N-terminalnih OB1 domena. Nasuprot tome, homodimerizacija Candida Proteini Cdc13 i CgCdc13 posreduje OB pregib C-terminala. Upotreba OB4 za dimerizaciju CgCdc13 pomalo iznenađuje, s obzirom na bližu srodnost ovog kvasca Saccharomyces nego da Candida spp. Možda ovo predstavlja još jedan slučaj konvergentne evolucije. Na primjer, slučajni gubitak dimerizacije OB1 CgCdc13 je možda pružio selekcijski pritisak za razvoj drugih mehanizama dimerizacije, što je na kraju rezultiralo upotrebom OB4. Prevalencija dimerizacije Cdc13 sugerira da ovo svojstvo može olakšati interakciju Cdc13 s više ciljeva. Na primjer, jedna utvrđena funkcija dimerizacije OB1 je olakšavanje interakcije s Pol1. Naši podaci o mutagenezi jasno su pokazali da je dimerizacija ScZa vezanje Pol1 potrebna je Cdc13 OB1 domena. Značaj dimerizacije OB4 manje je jasan. Moguća funkcija dimerizacije ove domene sugerirana je homodimerizacijom mnogih proteina koji vežu telomere, poput fisionog kvasca Taz1 i humanih TRF1 i TRF2 42, 43, 44, 45, 46. Zbog niskog unutrašnjeg afiniteta pojedinih domena koje se vezuju za DNK, ovi proteini zahtijevaju dimerizaciju za stabilnu interakciju DNK telomera 42, 44, 46. Dakle, iako je S. cerevisiae Cdc13 može jasno vezati DNK kao monomer, moguće je da dimerizacija manjih proteina Cdc13 u Candida spp. mogu pojačati njihovu aktivnost vezanja za DNK. Zaista, nedavno smo otkrili da je OBDBD of CtCdc13 slabo stupa u interakciju sa srodnim ponavljanjem telomera i zahtijeva OB4 domenu za visoko afinitetno vezanje DNK (EYY i NL, rukopis u pripremi). Još jedna potencijalna funkcija dimerizacije Cdc13 sugerirana je prijavljenom multimerizacijom kompleksa telomeraze. Iako su podaci donekle neuvjerljivi, predloženo je da i kvasac i ljudska telomeraza funkcioniraju kao zatamnjivači 47, 48. Budući da je poznato da Cdc13 stupa u interakciju s Est1 komponentom telomeraze kvasca, dimerizacija Cdc13 mogla bi pomoći dovesti dva kompleksa telomeraze u blisku blizinu radi pravilne funkcije. Potrebne su daljnje studije kako bi se ispitale ove mogućnosti i otkrio potpuni funkcionalni značaj dimerizacije Cdc13 u regulaciji i održavanju rastućih telomera kvasca.


REZULTATI

Validacija WBS-PCR pomoću endogeno eksprimiranih mRNA

Postupak WBS-PCR (dopunska slika S1) koristi sagitalne presjeke miša od 40 μm, tipično generirane za studije biodistribucije novih radioaktivno obilježenih terapijskih spojeva koji uključuju kvantitativnu autoradiografiju cijelog tijela (QWBA) (14), prostornu rezoluciju ploče sa okruglim bunarima iz 1536 i snažnog pufera za lizu tkiva. Postavljanjem sekcije miša na unaprijed napunjenu ploču s 1536 jažica i vađenjem cilja iz izloženih tkiva jednostavnim preokretanjem ploče, cijeli se odjeljak dekonvoluira u zasebne lizate tkiva, koji se mogu podvrgnuti nizvodnim analitičkim ispitivanjima, kao što je RT-qPCR. Obično dio miša pokriva 363 jažice ploče sa 1536 jažica koje, kada se analizira na qPCR ploči s 384 jažica, rezervira 20 jažica za uključivanje referentnih uzoraka ili standarda. Nakon toga, uz upotrebu proračunskih tablica (tj. Excel) i softvera za snimanje (npr. Tissue View), lokalizacija analita se vizualizira pretvaranjem qPCR signala u sliku i preklapanjem sa slikom snimljenom poprečnog presjeka cijelog tijela. prije postupka ekstrakcije.

Budući da različite endogene RNA i oligonukleotidi (tj. MRNA, miRNA, siRNA i antagomir) zahtijevaju različite metode pročišćavanja za njihovu optimalnu izolaciju iz tkiva, istražili smo mogućnost mjerenja njihovih razina izravno u tkivnim lizatima bez potrebe za opsežnim koracima pročišćavanja. Ovaj pristup minimizira gubitak intenziteta signala zbog pristrasnih postupaka pročišćavanja i omogućava visoku analizu uzorka kroz robote za rukovanje tekućinom. Još jedna prednost ovog pristupa je ta što lizati sadrže endogenu genomsku DNK, koja se može koristiti za normalizaciju signala mRNA dobivenih u RT-qPCR (15, 16) bez potrebe za analizom velikih panela gena za održavanje (17). S druge strane, potencijalni nedostatak ovog pristupa je to što većina reagensa koji se koriste za pripremu tkivnih lizata sadrže snažne proteinske denaturante, visoke koncentracije soli i kelatne tvari, koje mogu inhibirati ili smanjiti učinkovitost enzimskih reakcija potrebnih za kvantifikaciju (18) . Međutim, iskorištavanjem osjetljivosti tipičnih testova zasnovanih na RT-qPCR, upotreba ovih reagensa mogla bi biti dopuštena uvrštavanjem koraka razrjeđivanja za smanjenje ili uklanjanje inhibitornih elemenata uvedenih tokom postupka ekstrakcije. Testirali smo nekoliko pufera za lizu i otkrili da je Clarity OTX pufer za lizu najkompatibilniji sa RT-qPCR. Kako bismo pokazali ovu kompatibilnost, uspostavili smo profile ekspresije male ploče tkivno specifičnih mRNA dobivenih izlaganjem razrijeđenih tkivnih lizata (slika 1a, dopunska tablica S1) direktno u RT-qPCR reakciju. Također smo mjerili nivoe genomskog 18S u lizatima pomoću qPCR -a i koristili ove interne referentne signale za normalizaciju dobivenih signala mRNA. Kompatibilnost pufera za lizu tkiva s RT-qPCR potvrđena je s nekoliko specifičnih profila ekspresije: mRNA koja veže protein-faktor 1 (IGFBP-1) slična inzulinu bila je ograničena na jetru i bubreg (19), teški lanac miozina 6 (Myh6 ) mRNA se mogla otkriti samo u lizatima pripremljenim iz srca i pluća (20), a mRNA koja kodira mijelinski osnovni protein (Mbp) (21) mogla se otkriti isključivo u mozgu. Očekivano, slični obrasci ekspresije primijećeni su kada su reakcije RT-qPCR izvedene korištenjem pročišćene ukupne RNK (dopunska slika S2, dopunska tablica S2).

Biodistribucija endogenih i egzogenih tkiva specifičnih mRNA. ( a ) Kompatibilnost pufera za lizu tkiva potvrđena je karakteriziranjem profila ekspresije mRNA specifičnih za tkivo: protein sličan inzulinu koji veže faktor rasta 1 (IGFBP1), teški lanac miozina 6 (Myh6) i osnovni mijelinski protein (Mbp) u lizatima pripremljeno od timusa (Th), pluća (Lu), srca (H), skeletnih mišića (SM), bubrega (K), mozga (B), jetre (Li) i slezene (S). Signali su normalizirani u odnosu na genomski 18S, a maksimalni prosječni signal za svaku mRNA postavljen je na 100%. ( b ) WBS-PCR biodistribucija mRNA označena sa (a). WBS (gornja ploča) predstavlja dio cijelog tijela prije lize. Napomena o tkivu: Mozak (B), Kičmena moždina (Sc), Pljuvačne žlijezde (Sg), Srce (H), Jetra (Li), Krv (Bd) i Gastro-intestinalni trakt (GI). Svi signali su normalizirani u odnosu na genomski 18S (donja ploča). ( c ) WBS-PCR biodistribucija mRNK humanog embriona, abnormalnog vida, Drosophila-like 1 (ELAVL1), human Actin Beat (Actb) i gliceraldehid 3-fosfat dehidrogenaze (GAPDH) u HCT-116 humanom tumorskom mišu. Oznaka tkiva u WBS-u: Oko (E), Mozak (B), Jetra (Li), Gastro-intestinalni trakt (GI) i tumor HCT-116 (T). Svi signali su normalizirani u odnosu na genomski 18S (donja ploča).

Biodistribucija endogenih i egzogenih tkivno specifičnih mRNA. ( a ) Kompatibilnost pufera za lizu tkiva potvrđena je karakteriziranjem profila ekspresije mRNA specifičnih za tkivo: protein sličan inzulinu koji veže faktor rasta 1 (IGFBP1), teški lanac miozina 6 (Myh6) i osnovni mijelinski protein (Mbp) u lizatima pripremljeno od timusa (Th), pluća (Lu), srca (H), skeletnih mišića (SM), bubrega (K), mozga (B), jetre (Li) i slezene (S). Signali su normalizirani u odnosu na genomski 18S, a maksimalni prosječni signal za svaku mRNA postavljen je na 100%. ( b ) WBS-PCR biodistribucija mRNA označena sa (a). WBS (gornja ploča) predstavlja dio cijelog tijela prije lize. Napomena o tkivu: Mozak (B), Kičmena moždina (Sc), Žlijezda slinovnica (Sg), Srce (H), Jetra (Li), Krv (Bd) i Gastro-intestinalni trakt (GI). Svi signali su normalizirani u odnosu na genomski 18S (donja ploča). ( c ) Biodistribucija WBS-PCR humanih embrionalnih smrtonosnih, abnormalnih vidova, Drosophila-like 1 (ELAVL1), humanog Actin Beat-a (Actb) i gliceraldehid-3-fosfat dehidrogenaze (GAPDH) mRNA u HCT-116 humanom tumorskom mišu. Oznaka tkiva u WBS-u: Oko (E), Mozak (B), Jetra (Li), Gastro-intestinalni trakt (GI) i tumor HCT-116 (T). Svi signali su normalizirani u odnosu na genomski 18S (donja ploča).

Kao sljedeći korak, biodistribucija iste ploče ciljeva mRNA ispitana je pomoću WBS-PCR metode (slika 1 b). Efikasnost postupka ekstrakcije praćena je mjerenjem genomskih 18S signala po cijelom presjeku tijela (slika 1b, donja ploča). Kao što se očekivalo, genomski 18S pokazao je sveukupnu homogenu biodistribucijsku shemu s nekim povišenim razinama primijećenim u mozgu. Ovi povišeni nivoi mogu biti posljedica varijacija u gustoći ćelija tkiva i efikasnosti ekstrakcije. Da bi se kompenzirale ove potencijalne pristranosti, svi WBS-PCR signali se korigiraju u odnosu na genomski 18S. Za razliku od genomskog 18S, ciljevi mRNA pokazali su jasnije obrasce biodistribucije koji su potvrđivali profile ekspresije dobivene za homogenate tkiva u svim slučajevima. Uzorak biodistribucije dobiven za mRNA IGFBP-1 kolokaliziran je s jetrom, dok mHNA signali Myh6 kolokalizirani samo sa srčanom regijom. Zanimljivo je da je obrazac biodistribucije Mbp potvrdio ekspresiju mRNA u mozgu, ali zanimljivo i u regijama duž leđne moždine. Zaintrigiran ovim opažanjem, reakcija RT-qPCR je ponovljena na pročišćenoj ukupnoj RNK (dopunska slika S2 i dodatna tabela S2), a prisustvo Mbp mRNA u mozgu i leđnoj moždini moglo se potvrditi. Ovo zapažanje ilustrira moć WBS-PCR-a u vizualizaciji biodistribucije nekarakteriziranih mRNA.

Kako bismo dodatno potvrdili optičku rezoluciju koja se može postići WBS-PCR-om, istražili smo obrazac biodistribucije ljudskih mRNA koji kodiraju ELAVL1 (embrionalno smrtonosno, abnormalni vid, Drosophila-like 1), Actb (Beta-aktin) i GAPDH (gliceraldehid-3) -fosfat dehidrogenaza) u presjeku dobijenom od miša koji nosi humani tumor (HCT-116) (slika 1 c) korištenjem humanih specifičnih RT-qPCR prajmera. Kao što se očekivalo, obrazac biodistribucije za ljudske mRNA ko-lokaliziran je točno u regiji rasta tumora. Budući da 18S početnici prepoznaju i ljudske i mišje sekvence, genomski 18S se može otkriti po cijelom presjeku s povišenim nivoima u tumorskoj regiji (slika 1 c, donja ploča). Uzeti zajedno, ovi podaci ukazuju na to da dekonvolucija dijela miša cijelog tijela u 363 odvojena uzorka, nakon čega slijedi ponovno sastavljanje RT-qPCR signala u sliku, može generirati točne interpretabilne podatke o biodistribuciji i može pružiti detaljnije informacije o izrazu nego što može potječu iz pojedinačno izoliranih tkiva.

PCR skeniranjem cijelog tijela radi lokalizacije miRNA i siRNA

Gore navedeni podaci o biodistribuciji RNA dobiveni su korištenjem visoko specifičnog TaqMan testa, koji se oslanja na specifičnu amplifikaciju ciljnog gena pomoću dva prajmera i hidrolizu TaqMan sonde. Iako su opisani slični testovi zasnovani na sondi za otkrivanje siRNA (22, 23), mi smo krenuli u razvoj RT-qPCR testa s ciljem smanjenja količine koraka rukovanja uzorkom bez ugrožavanja specifičnosti testa ili osjetljivosti (Slika 2 a ). Kao i većina testova, prvi korak se oslanja na klasičnu konverziju RNK u cDNK pomoću produžetka prajmera posredovanog reverznom transkriptazom (24). U drugom koraku, qPCR-mješavina se direktno dodaje reakciji obrnute transkripcije inaktiviranom toplinom, nakon čega slijedi PCR reakcija na bazi gašenja protiv prajmera (25). Fluorescentna kvantifikacija u stvarnom vremenu odvija se tokom produžnog ciklusa PCR reakcije. Tokom ovog ciklusa, neinkorporirani prajmeri će se ugasiti anti-prajmerom označenim za gašenje, dok prednji prajmeri koji čine dvolančane PCR proizvode neće. Eksponencijalno povećanje fluorescentnog signala bit će rezultat uspješnog pojačanja mete. Budući da su miRNA i siRNA slične veličine i stoga predstavljaju slične izazove u pogledu dizajniranja pouzdanih prajmera, specifičnost testa je procijenjena u tipičnoj matričnoj studiji u kojoj je razina unakrsne reaktivnosti mjerena na ploči blisko povezanih Let-7 članovi porodice miRNA (slika 2 b).Uzimajući u obzir da je savršeno usklađeni cilj proizvoljno postavljen na 100%, najveća unakrsna reaktivnost (∼3%) je primijećena samo kada su nivoi Let-7d i Let-7b određeni pomoću prajmera dizajniranih prema Let-7a ili Let-7c , respektivno. Sve ostale kombinacije šablona/prajmera rezultirale su minimalnom unakrsnom reaktivnošću u rasponu od 0 do 1%. Slični nivoi specifičnosti zabilježeni su korištenjem komercijalno dostupnih TaqMan testova miRNA (26). Osim toga, svi Let-7 testovi su prikazivali veliki dinamički raspon (8-10 dnevnika) s donjom granicom detekcije u rasponu od 0,02 do 0,002 femtograma, ističući razinu osjetljivosti koja se može postići pomoću ovog RT-qPCR testa (Dopunska slika S3). Performanse RT-qPCR testa dodatno su okarakterisane merenjem relativnih nivoa ekspresije panela miRNA u istim prethodno opisanim homogenatima miševskih organa (slika 2c i dodatna tabela S3). Očekivano, otkrivanje dobro karakteriziranih miRNA specifičnih za srce i mišiće (npr. MiR-208a, miR-1a, miR-133a), specifičnih za jetru (npr. MiR-122) i miRNA obogaćenih mozgom (npr. MiR-124, miR-127, miR-128, miR-132, miR-137, miR-139) u odgovarajućim organima (27-29) potvrđuje kompatibilnost naše metode s mjerenjem miRNA direktno u tkivnim lizatima. Osim toga, RT-qPCR analiza miRNA 122-5p, 208a-3p, 124-3p, 124-5p, 191-5p i 16-5p koristeći ukupnu RNA kao ulaz u reakciju rezultirala je sličnim profilima ekspresije (dopunska slika S4 i dodatna tabela S4). Uzeti zajedno, podaci snažno ukazuju na to da je postupak lize zaista kompatibilan sa specifičnim otkrivanjem miRNA dobivenih iz tkiva.

Karakterizacija i validacija miRNA RT-qPCR metode. ( a ) RT-qPCR test za miRNA i siRNA. RT/Reverse prajmer se koristi za generisanje cDNA kopije RNA šablona tokom koraka obrnute transkripcije. Fluorescentna kvantifikacija u stvarnom vremenu odvija se tokom qPCR koraka uz pomoć fluorescentno označenog Forward prajmera koji se hibridizira sa produženim RT/Reverse prajmerom. Signali generisani inkorporiranim premaznim premazima se gase pomoću anti-prajmera označenog za gašenje. ( b ) Specifičnost metode RT -qPCR provjerena je analizom intenziteta pozadinskog signala generiranog prajmerima specifičnim za let -7 miRNA, koristeći Let -7a, -7b, -7c, -7d, -7e, -7f, - 7g, -7i kao šablon u reakciji. Prosječne vrijednosti za savršeno usklađene ciljeve postavljene su na 100%. Trake grešaka, STDEV ( n = 4). ( c ) profil ekspresije miRNA u razrijeđenim homogenatima tkiva: timus (Th), pluća (Lu), srce (H), skeletni mišić (S.M), bubreg (K), mozak (B), jetra (Li) i slezena (S). Signali su normalizirani u odnosu na genomski 18S, a maksimalni prosječni signal za svaku mRNA postavljen je na 100%.

Karakterizacija i validacija miRNA RT-qPCR metode. ( a ) RT-qPCR test za miRNA i siRNA. RT/Reverse prajmer se koristi za generisanje cDNA kopije RNA šablona tokom koraka obrnute transkripcije. Fluorescentna kvantifikacija u stvarnom vremenu odvija se tokom qPCR koraka uz pomoć fluorescentno označenog Forward prajmera koji se hibridizira sa produženim RT/Reverse prajmerom. Signali generisani inkorporiranim premaznim premazima se gase pomoću anti-prajmera označenog za gašenje. ( b ) Specifičnost metode RT -qPCR provjerena je analizom intenziteta pozadinskog signala generiranog prajmerima specifičnim za let -7 miRNA, koristeći Let -7a, -7b, -7c, -7d, -7e, -7f, - 7g, -7i kao šablon u reakciji. Prosječne vrijednosti za savršeno usklađene ciljeve postavljene su na 100%. Trake grešaka, STDEV ( n = 4). ( c ) profil ekspresije miRNA u razrijeđenim homogenatima tkiva: timus (Th), pluća (Lu), srce (H), skeletni mišić (S.M), bubreg (K), mozak (B), jetra (Li) i slezena (S). Signali su normalizirani u odnosu na genomski 18S, a maksimalni prosječni signal za svaku mRNA postavljen je na 100%.

Specifičnost RT-qPCR testa dodatno je podržana uzorcima biodistribucije dobivenim za tkivno specifične miRNA miR-122 (jetra), miR-208a (srce) i miR-124-3p/-5p (mozak), i sveprisutno eksprimirane miRNAs miR-191 i miR-16, koristeći WBS-PCR metodu (slika 3 a). Opet, genomski 18S je korišten za potvrdu efikasnosti ekstrakcije i za normalizaciju svih miRNA signala (slika 3, donja ploča). Zanimljivo je da je ekspresija miR-124-3p i miR-124-5p, oboje obrađena iz iste pre-miRNA, pokazala vrlo slične obrasce bio-distribucije specifične za mozak.

Biodistribucija miRNA specifičnih za endogeno tkivo i siRNA označene egzogenim tricijumom. ( a ) Biodistribucija miRNA specifičnih za tkivo pomoću WBS-PCR. Napomena o tkivu: Mozak (B), Srce (H), Jetra (Li), Želudac (St) i Gastro-intestinalni trakt (GI). Svi signali su normalizirani u odnosu na genomski 18S (donja ploča). ( b ) Biodistribucija nemumulirane siRNA označene tritijem koja cilja Mrp4 fosfornim snimanjem (QWBA) i WBS-PCR (Mrp4 siRNA) 10 minuta nakon doziranja (što je bjelje područje u autoradiogramima koristeći QWBA, veća je koncentracija radioaktivnosti), kao i WBS-PCR vizualizacija biodistribucije dobivene za miR-191. Svi miRNA i siRNA signali normalizirani su u odnosu na genomski 18S (donja ploča). ( c ) Granica detekcije RT-qPCR testa korištenjem 3′-skraćenog (gornji panel), 5′ -sječenog (srednja ploča) i 3 ′/5′ -sječenog (donji panel) Mrp4 niti protiv osjetila kao obrazac u reakciji.

Biodistribucija miRNA specifičnih za endogeno tkivo i siRNA označena egzogenim tricijumom. ( a ) Biodistribucija miRNA specifičnih za tkivo pomoću WBS-PCR. Napomena o tkivu: Mozak (B), Srce (H), Jetra (Li), Želudac (St) i Gastro-intestinalni trakt (GI). Svi signali su normalizirani u odnosu na genomski 18S (donja ploča). ( b ) Biodistribucija nemumulirane siRNA označene tritijem koja cilja Mrp4 fosfornim snimanjem (QWBA) i WBS-PCR (Mrp4 siRNA) 10 minuta nakon doziranja (što je bjelje područje u autoradiogramima koristeći QWBA, veća je koncentracija radioaktivnosti), kao i WBS-PCR vizualizacija biodistribucije dobivene za miR-191. Svi miRNA i siRNA signali normalizirani su u odnosu na genomski 18S (donja ploča). ( c ) Granica detekcije RT-qPCR testa korištenjem 3′-skraćenog (gornji panel), 5′ -sječenog (srednja ploča) i 3 ′/5′ -sječenog (donji panel) Mrp4 niti protiv osjetila kao obrazac u reakciji.

Kao stroži test, uspoređivali smo obrazac biodistribucije WBS-PCR metode s tradicionalnim kvantitativnim autoradiografom cijelog tijela (QWBA) dobivenim od miša intravenozno doziranog s neimuliranom, tritijem označenom siRNA koja cilja na protein 4 rezistencije na štakore (Mrp4 siRNA) (10) (slika 3 b i dopunska slika S5). Analiza sekcije miša, žrtvovana 10 minuta nakon intravenske doze, otkrila je da su visoki nivoi ukupnih radioaktivno obilježenih komponenti uočeni u bubrezima i jetri, predstavljeni bijelim regijama u autoradiogramima koristeći QWBA, također prisutni u obrascu biodistribucije dobivenom pomoću WBS -a -PCR metoda. Unatoč prisutnosti radioaktivnosti u žlijezdi slinovnici, WBS-PCR nije uspio potvrditi prisutnost siRNA u ovom organu. Nedostatak siRNA RT-qPCR signala ne može se pripisati lošoj efikasnosti ekstrakcije zbog jasnog prisustva i genomskih 18S i miR-191 u ovoj regiji. Zaista, LC-MS analiza je potvrdila da radioaktivni signal uočen u žlijezdi slinovnici ne predstavlja signal netaknute siRNA, već signal tritiranog metabolita mono-Uridina (podaci nisu prikazani). Da bismo istražili ograničenje RT-qPCR-a u odnosu na otkrivanje metabolita, generirali smo različita skraćenja lanca protiv osjetila dupleksa siRNA, ubacili ih u ukupnu RNA štakora i za svaki šablon odredili najnižu količinu cilja koja bi još uvijek mogla biti može se otkriti pomoću RT-qPCR (slika 3 c). Kao što se očekivalo, brisanje više od dva nukleotida na 5 'ili 3' kraju ciljne sekvence dovodi do brzog smanjenja osjetljivosti testa RT-qPCR. Zbog toga RT-qPCR također ne bi otkrio metabolite kao što je mono-Uridin. Uzeti zajedno, ovi podaci potvrđuju da signali dobiveni u WBS-PCR-u potječu ili iz RNA pune dužine ili iz minimalno krnjih metabolita. Dodatno, nedostatak detekcije metabolita, poput mono-Uridina, osigurava specifičnost signala, dok klasični QWBA pristup omogućava otkrivanje ukupne radioaktivnosti iz matičnih spojeva i metabolita.

PCR skeniranjem cijelog tijela radi lokalizacije kemijski modificiranih oligonukleotida

Većina terapeutskih oligonukleotida sadrži različite stupnjeve kemijskih modifikacija za davanje odgovarajućih karakteristika kao što su otpornost na nukleazu, afinitet, specifičnost, sigurnost, distribucija i stanično uzimanje. Iako kemijske modifikacije mogu poboljšati farmakokinetička i dinamička svojstva ovih oligonukleotida, one također predstavljaju analitičke izazove. Na primjer, 2′- o -Metil-modificirani oligonukleotid anti-miRNA-16 (AMO-miR-16) lako se može otkriti pomoću RT-qPCR (30), dok je 2′- o -(2-metoksietil) -modifikovana sekvenca nije (dopunska slika S6). Iz tog razloga, razvili smo CL-qPCR test dvostupanjski test koji koristi qPCR za kvantificiranje količine proizvoda nastalog u samo-usmjerenoj kemijskoj ligaciji dva oligodeoksinukleotida koju je predložio potpuno komplementarni analit (11, 31) (Dopunski Slika S7a), neovisno o slijedu (dopunska slika S7b) ili kemijskim modifikacijama prisutnim u predlošku (dopunska slika S8). Tokom prvog koraka, vezivanje dva DNA oligonukleotida, jedno pored drugog, na meti inicira reakciju nukleofilne fosforotioatne grupe, koja se nalazi na 3′-kraju jednog oligonukleotida, sa elektrofilnim ugljenikom na 5′- kraj susjednog oligonukleotida. Ova reakcija ovisna o blizini rezultira pomicanjem odlazeće grupe sulfonata i stvaranjem veze ugljik-sumpor, kovalentno povezujući dva oligonukleotida u jedan jedinstveni DNK-oligonukleotid (slika 4 a), koji se može kvantificirati pomoću PCR-a, unatoč veza ugljik -sumpor nešto je duža od veze ugljik -kisik regularne DNK.

Potvrda biodistribucije dobivene za AMO-miR-16 upotrebom CL-qPCR. ( a ) Hemijska reakcija koja se javlja tokom hibridizacije ciljane rame uz rame DNA-oligo koja sadrži 3′-fosforotioatnu grupu i DNA-oligo koja sadrži 5′-bifenilsulfonilnu grupu. Reakcija ovisna o udaljenosti posredovana šablonom dovodi do pomicanja izlazne grupe bifenilsulfonila i stvaranja veze ugljik-sumpor. (BAZA predstavlja adenozin, gvanozin, timidin ili citidin). ( b ) Kvantifikacija AMO-miR-16 u plazmi izoliranoj od miševa tretiranih AMO-miR-16- (crni) i PBS-om (sivi). Vrijednosti su prosjek trostrukih mjerenja pet životinja. Trake grešaka, s.e.m ( n = 15). * P & lt 0,05 (Mann – Whitneyjev test sume rangova). ( c ) Biodistribucija miR-16 i AMO-miR-16 određena je na dijelovima cijelog tijela miša, tretirana AMO-miR-16 (lijeva ploča) ili PBS (desna ploča) i normalizirana u odnosu na genomski 18S. Napomena o tkivu: Oko (E), Mozak (B), Pluća (Lu), Srce (H), Jetra (Li), Želudac (St), Bubreg (K), Kost (Bo) i Gastro-intestinalni trakt (GI) . ( d – f ) Kvantifikacija AMO-miR-16 (d), miR-16 (e) i miR-191 (f) u tkivima izoliranim od miševa tretiranih AMO-miR-16 (crno) ili PBS (sivo). Vrijednosti su prosjek trostrukih mjerenja četiri životinje. Trake grešaka, s.e.m. ( n = 12). * P & lt 0,05 [Test Mann – Whitney Rank Sum (d i e), t -test (f), n.s .: nije značajno].

Potvrda biodistribucije dobivene za AMO-miR-16 upotrebom CL-qPCR. ( a ) Hemijska reakcija koja se događa tokom hibridizacije ciljane rame uz rame DNA-oligo koja sadrži 3′-fosforotioatnu grupu i DNA-oligo koja sadrži 5′-bifenilsulfonilnu grupu. Reakcija ovisna o udaljenosti posredovana šablonom dovodi do pomicanja izlazne grupe bifenilsulfonila i stvaranja veze ugljik-sumpor. (BAZA predstavlja adenozin, gvanozin, timidin ili citidin). ( b ) Kvantifikacija AMO-miR-16 u plazmi izoliranoj od miševa tretiranih AMO-miR-16- (crni) i PBS-om (sivi). Vrijednosti su prosjek trostrukih mjerenja pet životinja. Trake grešaka, s.e.m ( n = 15). * P & lt 0,05 (Mann – Whitneyjev test sume rangova). ( c ) Biodistribucija miR-16 i AMO-miR-16 određena je na dijelovima cijelog tijela miša, tretirana AMO-miR-16 (lijeva ploča) ili PBS (desna ploča) i normalizirana u odnosu na genomski 18S. Napomena o tkivu: Oko (E), Mozak (B), Pluća (Lu), Srce (H), Jetra (Li), Želudac (St), Bubreg (K), Kost (Bo) i Gastro-intestinalni trakt (GI) . ( d – f ) Kvantifikacija AMO-miR-16 (d), miR-16 (e) i miR-191 (f) u tkivima izoliranim od miševa tretiranih AMO-miR-16 (crno) ili PBS (sivo). Vrijednosti su prosjek trostrukih mjerenja četiri životinje. Trake grešaka, s.e.m. ( n = 12). * P & lt 0,05 [Test Mann – Whitney Rank Sum (d i e), t -test (f), n.s .: nije značajno].

Zatim smo istražili biodistribuciju AMO-miR-16 modificirane MOE koristeći CL-qPCR. Za to su dvije grupe miševa, od kojih se svaka sastojala od pet životinja, intravenozno dozirane s AMO-miR-16 (80 mg/kg) ili PBS-om. Uzorci plazme su prikupljani u različitim vremenskim tačkama u periodu od 24 sata, a nivoi AMO-miR-16 kvantifikovani su pomoću CL-qPCR metode. Kao što se očekivalo, AMO-miR-16 se brzo očistio iz plazme dostigavši ​​nivoe koji se ne mogu otkriti unutar 1 h nakon doziranja (Slika 4b i Dodatna slika S9). Unatoč brzom klirensu plazme, WBS-PCR na presjecima dobivenim 24 sata nakon doziranja otkrio je široki obrazac biodistribucije AMO-miR-16, što ukazuje na opsežno usvajanje AMO-miR-16 u velikom broju tkiva (slika 4 c). Najviši nivoi AMO-miR-16 mogli su se primijetiti u bubrezima, dok se u uzorcima koji su lokalizirani s mozgom nije mogao otkriti nikakav signal. Zanimljivo je da 20-merni MO-modificirani PO oligonukleotid modificiran MOE koji cilja na ljudsku međućelijsku adhezionu molekulu-1 mRNA doziranu na štakorima pokazuje sličan farmakokinetički profil plazme i obrazac biodistribucije, potvrđujući performanse CL-qPCR (32). Osim toga, doziranje AMO-miR-16 smanjilo je globalnu biodistribucijsku razinu miR-16 u životinja tretiranih AMO-miR-16 u usporedbi s onima u životinja tretiranih PBS-om. Biodistribucija genomskog 18S, s druge strane, bila je vrlo slična između dvije životinje i nije sugerirala da bi nedostatak miR-16 mogao biti posljedica slabe učinkovitosti ekstrakcije. Da bi se potvrdilo posmatranje WBS-PCR, izmjereni su nivoi AMO-miR-16 (slika 4 d i dopunska slika S10) i miR16 (slika 4 e i dopunska slika S11) u organima izoliranim od preostale četiri životinje. Zaista, kvantifikacija AMO-miR-16 pomoću CL-qPCR potvrdila je prisutnost spoja u bubrezima, jetri, plućima i slezeni, ali ne i u mozgu tretiranih životinja. Prisutnost AMO-miR-16 također je značajno smanjila nivo miR-16 u ovim tkivima, dok su nivoi miR-191 (slika 4 f i dopunska slika S12) ostali nepromijenjeni, što ukazuje na to da bi gubitak miR-16 zaista mogao biti rezultat AMO vezivanje. Uzeti zajedno, ovi podaci potvrđuju i robusnost CL-qPCR metode u kvantifikaciji jako kemijski modificiranih oligonukleotida u biološkim uzorcima i njenu primjenu u studijama biodistribucije koristeći WBS-PCR.


Učinak strukturnih nivoa na površinski poboljšano ramansko rasipanje ljudskih telomernih G-kvadrupleksa u razrijeđenim i pretrpanim medijima

Ljudski telomerni G-kvadrupleksi nove su mete u otkrivanju lijekova protiv raka jer su sposobni efikasno inhibirati telomerazu, enzim koji je uvelike uključen u nestabilnost telomera i proces immortalizacije u malignim stanicama. G-kvadrupleksna (G4) DNK je visoko polimorfna i može usvojiti različite topologije nakon dodavanja elektrolita, aditiva i liganda. Međutim, proučavanje G-kvadrupleksnih oblika pod različitim uvjetima moglo bi biti prilično izazovno. U ovom je radu primijenjena spektroskopija Ramanovog raspršenja (SERS) s površinskim poboljšanjem za proučavanje G-kvadrupleksa nastalih ljudskim telomernim nizovima, d [A3G3(TTAGGG)3A2] (Tel26) i d [(TTAGGG)4T2] (wtTel26), u uslovima razblaženosti i gužve. SERS spektri karakteristični za hibrid-1 i hibrid-2 G-kvadruplekse Tel26, odnosno wtTel26, posmatrani su za sekvence presavijene u prisustvu jona K + (110 mM) u puferiranoj otopini, koja predstavlja razrijeđeni medij. Polietilen glikol (5, 10, 15, 20 i 40% v/v PEG) je korišten za stvaranje okruženja prepunog molekula, što je rezultiralo stvaranjem paralelnih G-kvadrupleksa obje proučene ljudske telomerne sekvence. Uprkos opsežnom preklapanju bendova gužve, prepoznate su SERS spektralne karakteristike koje ukazuju na paralelni G4 oblik Tel26. Dobiveni rezultati ukazuju na to da SERS G-kvadrupleksa odražava ne samo primarnu strukturu proučavane ljudske telomerne sekvence, uključujući njen sastav i slijed nukleobaze, već i njegovu sekundarnu strukturu u smislu Hoogsteenovih vodikovih veza odgovornih za stvaranje guanin tetrade, i konačno, njegova tercijarna struktura, definirajući trodimenzionalni oblik DNK, smještena blizu povećavajuće metalne površine.

Ovo je pregled sadržaja pretplate, pristup putem vaše institucije.


Koliki je naboj oligonukleotida 5 'pGpGpApCpT 3' pri pH 7,00? - Biologija

Otvoreni časopis primijenjenog biosenzora Vol.03 No.02 (2014), ID članka: 46020,8 stranice
10.4236/ojab.2014.32002

Detekcija gena za karcinom dojke 1 (BRCA1) pomoću elektrokemijskog biosenzora DNA na temelju imobiliziranih ZnO nanožica

Nur Azimah Mansor 1, Zainiharyati Mohd Zain 1, Hairul Hisham Hamzah 1, Mohd Shihabuddin Ahmad Noorden 2,3, Siti Safura Jaapar 2, Valerio Beni 4, Zafar Husain Ibupoto 5

1 Fakultet primijenjenih nauka, Univerzitetska tehnologija MARA, Shah Alam, Malezija

2 Farmaceutski fakultet, Universiti Teknologi MARA, Puncak Alam, Malezija

3 Atta-ur-Rahman Institut za otkrivanje prirodnih proizvoda, Universiti Tehnologi MARA, Puncak Alam, Malezija

4 Centar za biosenzore i bioelektroniku, Odsjek za fiziku, hemiju i biologiju, Univerzitet Link & oumlping, Link & oumlping, Švedska

5 Odsjek za fizičku elektroniku i nanotehnologiju, Odsjek za nauku i tehnologiju (ITN), Kampus Norrk & oumlping, Link & oumlping University, Norrk & oumlping, Švedska

Autorska prava i kopija 2014 od strane autora i Scientific Research Publishing Inc.

Ovo djelo je licencirano pod međunarodnom licencom Creative Commons Attribution International (CC BY).

Primljeno 14. februara 2014. revidirano 1. aprila 2014. prihvaćeno 8. aprila 2014. godine

Ovdje izvještavamo elektrokemijski biosenzor DNA za brzo otkrivanje sekvence (5 ’AAT GGA TTT ATC TGC TCT TCG 3’) specifične za gen raka dojke 1 (BRCA1).Predloženi elektrokemijski genosenzor zasnovan je na kratkoj oligonukleotidnoj DNK sondi imobiliziranoj na nanožicama cinkovog oksida (ZnONWs) kemijski sintetiziranim na zlatnu elektrodu hidrotermalnom tehnikom. Morfološke studije ZnONW -a, provedene elektronskom mikroskopijom skeniranja emisije na terenu (FESEM), pokazale su da su ZnO nanožice ujednačene, vrlo guste i orijentirane okomito na podlogu. Događaj prepoznavanja između DNK sonde i mete istražen je diferencijalnom pulsnom voltametrijom (DPV) u 0,1 M otopini acetatnog pufera (ABS), pH 7,00 kao rezultat hibridizacije, uočen je oksidacijski signal na +0,8 V. Utjecaji Ispitani su pH, ciljna koncentracija i nepotpuna DNK o performansama biosenzora. Predloženi biosenzor DNK ima sposobnost detekcije ciljne sekvence u rasponu koncentracije između 10,0 i 100,0 & microM sa granicom detekcije od 3,32 & microM. Eksperimentalni rezultati pokazali su da su pripremljene ZnONWs/Au elektrode pogodna platforma za imobilizaciju DNK.

Nanožice cinkovog oksida, biosenzor DNA, gen za rak dojke, BRCA1, hibridizacija DNA, diferencijal

Rak dojke, koji pogađa uglavnom unutrašnju oblogu mliječnih kanala, jedan je od glavnih uzroka smrti našeg doba. Udaljene metastaze smatraju se glavnim uzrokom smrti, pa je rana dijagnoza raka, a zatim i liječenje, iznimno potrebna [1]. Rak dojke povezan je s različitim genskim mutacijama, ali najčešće mutacije, sve povezane s aktivacijom stanica raka dojke, su BRCA1, BRCA2 i p53 koje su se dogodile u mehanizmima za ispravljanje grešaka. Ove mutacije su naslijeđene ili stečene nakon rođenja i obično promiču druge mutacije, što je dovelo do povećanja brzine diobe stanica, nedostatka vezivanja i metastaziranja na udaljene organe [2] [3]. Rak dojke 1 (BRCA1) je gen za suzbijanje tumora gdje je protein BRCA1 uključen u sprječavanje brzog i nekontroliranog rasta stanica. Mutacije u ovom genu onemogućuju BRCA1 protein da popravi oštećenu DNK, što dovodi do toga da ćelije nekontrolirano rastu i stvaraju tumor. Gen BRCA1 je identifikovan 1994. godine i nalazi se u regionu od 38.449.840 do 38.530.994 na osnovu para na traci 21 hromozoma 17 [4]. Ovaj gen je odgovoran za 40% rizika od raka dojke kod nosioca [5] [6]. Nakon toga, ove tačkaste mutacije predložene su kao mogući biomarkeri u ranom otkrivanju i skriningu raka dojke.

Konačno, platforme za određivanje lokacije specifično su potrebne za rano otkrivanje gena raka dojke tokom biopsije. To je zbog činjenice da postojeće tehnike otkrivanja nukleinskih kiselina (DNK), kao što su Northern blotting, testovi zaštite ribonukleazom, lančana reakcija reverzne transkripcije-polimeraze (RT-PCR) i sekvenciranje DNA, imaju nekoliko ograničenja, uključujući nisku osjetljivost, lošu selektivnost, skupo i nelinearno prema jačini cilja [7] [8]. Stoga će biti potrebni visoko specifični, brzi, jeftini i prikladni sistemi za otkrivanje gena za rak dojke koji će podržati kliničara za praćenje ranog napredovanja bolesti kod sumnjivih osoba. To će također omogućiti planiranje prikladnijeg liječenja raka kako bi se smanjila toksičnost prema specifičnoj vrsti tumorskih stanica [9]. Razvoj sensinga zasnovanog na DNK može biti alternativna pretraga vodiču. Posljednjih godina, elektrokemijskim biosenzorima DNA pridavana je velika pažnja pružajući jednostavne, tačne i brze odgovore, visoku osjetljivost, inherentnu selektivnost i jeftinu platformu za molekularnu detekciju [10].

Biosensor je kompaktni analitički uređaj koji ima element biološkog prepoznavanja blisko integriran s fizio-kemijskim pretvaračem. Tri glavne komponente biosenzora su: elementi biološkog prepoznavanja kao što su enzim, DNK, antitijelo i nukleinska kiselina, pretvarač koji pretvara događaj biološkog prepoznavanja u mjerljiv signal i na kraju sistem za obradu signala. Pet osnovnih pretvarača su optičke, termometrijske, elektrohemijske, piezoelektrične i magnetske. Elektrokemijska transdukcija zbog svoje bolje osjetljivosti, selektivnosti, ponovljivosti i lakog održavanja, kao i niske cijene, stekla je veliku popularnost u biosenzorima DNA [11] - [13]. Elektrokemijski biosenzori također su odigrali važnu ulogu u prijelazu na dijagnostički uređaj za mjesto njege, što su pokazali svjetski distribuirani senzori glukoze.

Osnovni princip biosenzora DNA obično se oslanja na imobilizaciju jednolančane oligonukleotidne (ssDNA) sonde na površini elektrode čime se na ovaj način daje specifičnost prema određenoj ciljnoj DNK. Događaj prepoznavanja, zasnovan na DNK hibridizaciji, tada se pretvaračem pretvara u čitljiv signal.

Performanse elektrokemijskog genosenzora uvelike se oslanjaju na svojstva pomoćnih materijala koji bi trebali pružiti dobro okruženje za imobilizaciju DNK, bez ugrožavanja njegove biološke aktivnosti i pružajući dobre transdukcijske sposobnosti [14]. Trenutno je upotreba nanomaterijala u području biosenzora postala jedan od najvećih istraživačkih interesa znanstvene zajednice zbog činjenice da oni nude mnoge prednosti, poput velikog omjera površine i volumena, velike površinske reakcijske aktivnosti i brze komunikacije elektronima. Nakon toga se pokazalo da elektrokemijski senzor dizajniran oko njih ima nisku granicu detekcije i dopušta otkrivanje analita iz malih količina [15]. Štaviše, sprezanje elektrokemijskih uređaja i materijala na nanomjerici nudi jedinstvenu mogućnost multipleksiranja za istovremena mjerenja više bio-markera [10]. Među tim nanomaterijalima, nanostrukture cinkovog oksida (ZnO) pružaju čvrstu platformu za bioosjetljivost. ZnO pokazuje izvrsna svojstva za proizvodnju biosenzora, kao što su dobra biokompatibilnost, kemijska stabilnost, netoksičnost i brza brzina prijenosa elektrona [16]. Najviše od svega, ZnO se ponaša kao izvrstan pretvarač zbog svoje visoke vrijednosti izoelektrične točke (IEP), približno 9,5, koja olakšava imobilizaciju niske izoelektrične IEP DNA ili proteina [17]. Među mnogim nanostrukturiranim ZnO, nanožice ZnO (ZnONW) su naširoko proučavane za imobilizaciju biomolekula [18]. Ove nanostrukture predstavljaju neka jedinstvena kemijska i fizička svojstva uzrokovana učinkom nanomjera koje pružaju nove mogućnosti za razvoj biosenzora DNA.

Nedavno su objavljeni izvještaji o elektrokemijskim genosensorima za otkrivanje gena i ćelija raka dojke [19] [20]. Međutim, do sada nije objavljen razvoj DNA biosenzora za otkrivanje gena raka dojke (BRCA1) na bazi modificirane zlatne elektrode. Glavni cilj ovdje opisanog rada bio je pokazati da ZnO nanožice, kemijski uzgojene na Au supstratu, mogu pružiti odgovarajuću platformu za razvoj elektrokemijskog DNK biosenzora za detekciju (BRCA1) gena. Nadalje, ovaj koncept mogao bi se dalje razraditi u nizu za multipleksirano otkrivanje drugih gena raka dojke, poput BRCA2 i p53, a može se primijeniti i na stvarne uzorke stanica raka dojke.

Elektrokemijska mjerenja provedena su na sobnoj temperaturi pomoću AUTOLAB-PGSTAT 302N (Echo Chemie, Nizozemska). Elektrohemijski sistem tri elektrode sastojao se od: ZnONWs/Au kao radne elektrode, platinaste žice kao pomoćne elektrode i Ag/AgCl kao referentne elektrode. DPV su izvedeni u 15 ml 0,1 M otopine acetatnog pufera (ABS) (pH 7,00) od 0,4 V do 1,16 V sa amplitudom modulacije = 0,025 V, intervalnim vremenom (t1) = 0,5 s, vremenom modulacije (t2) = 0,05 s, potencijal koraka = 0,005 V i brzina skeniranja 0,01 Vs −1. Rastvor acetatnog pufera je pročišćen gasom azota 20 minuta prije svakog eksperimenta. Površinu elektrode ZnONWs/Au karakterizirao je elektronski mikroskop za skeniranje emisije polja (FESEM).

Cinkov nitrat heksahidrat, Zn (NO3)2・ 6H2O, heksametilentetramin, C6H12N4, i cink acetat dehidrat, Zn (CH3COO)2∙ 2H2O su kupljene od Sigma Aldrich, Njemačka. Jednolančani DNK s 21 bazom su kupljeni od First BASE (IDT Inc, USA). Sekvence različitih oligonukleotida su sljedeće (podcrtane su neusklađene baze):

DNK sonde: 5 ’AAT GGA TTT ATC TGC TCT TCG 3’

Ciljna DNK: 5 ’CGA AGA GCA GAT AAA TCC ATT 3’

Nepodudaranje tri baze: 5 ’CGA AGA GGA GAA AAA TCG ATT 3’ 5 ’CAA AGA GCA GAT AGA TCC GTT 3’

Osnovni rastvori oligonukleotida (100 i mikroM) pripremljeni su s deioniziranom vodom i pohranjeni na 4 ° C kada se ne koriste. Rastvor acetatnog pufera (ABS) 0,1M koncentracije sa različitim pH vrijednostima pripremljen je miješanjem različitih volumena 0,1 M octene kiseline i natrij acetata s deioniziranom vodom.

2.3. Sinteza nanožica cinkovog oksida (ZnONW) na površini zlatne elektrode

Rast nanožica ZnO izveden je hidrotermalnom metodom. Prvo je zlatna elektroda/podloga na silikonskoj pločici kupljena od Sigma Aldrich, Stockholm, Švedska očišćena izopropanolom, isprana deioniziranom vodom i na kraju osušena na sobnoj temperaturi. Kao prvi korak sinteze, pripremljen je sloj sjemena cinkovog acetat dihidrata prevlačenjem tri puta na 2500 rpm 30 minuta na zlatnu podlogu. Nakon centrifugiranja, podloga je žarena na 120 ° C 10 - 20 minuta. Čestice sjemena koje sadrže elektrode pričvršćene su na držač za teflonski uzorak, a zatim uronjene u rastvor (0,075 M) heksahidrata cinkovog nitrata i (0,075 M) heksametilentetramina na 98 ° C 9 sati. Nakon završetka rasta ZnO, izrasle nanostrukture isprane su deioniziranom vodom kako bi se uklonile eventualne zaostale čestice. Na kraju su ZnONWs/Au elektrode ostavljene da se osuše na sobnoj temperaturi.

2.4. Imobilizacija sonde ssDNA na površinu ZnONWs/Au elektrode

40 & microL koje sadrže 80 & microM molekula ssDNA (sonda) su ispuštene na ZnONWs/Au elektrodu. Molekule ssDNA ostavljene su za imobilizaciju na ZnO NWs/Au elektrodi 2 sata. Nakon toga su pripremljene elektrode isprane ABS -om 5 s kako bi se uklonile nevezane sonde. Dobivena elektroda je označena kao ssDNA/ZnONWs/Au.

2.5. Hibridizacija ssDNA

Test hibridizacije izveden je uočavanjem na površinu senzora 40 & microL otopine koja sadrži željenu koncentraciju, 80 & microM komplementarne ssDNA, ne podudara se ssDNA i nekomplementarna ssDNA. Hibridizacija je ostavljena da se odvija 30 minuta. nakon toga je elektroda isprana ABS-om 5 s kako bi se uklonila ne-hibridizirana meta ssDNA.

3.1. Morfologije ZnONW -ove modificirane elektrode od zlata i imobilizirane ssDNA na površinu modificirane elektrode od ZnONW -a

Na slici 1 (A) prikazana je tipična FESEM slika uspješno hidrotermalno uzgojenih ZnONW na elektrodi sa zlatnom površinom. Jasno se vidi da su ukupno uzgojeni ZnONW visoko gusti i okomito poravnati sa šesterokutnim površinama prema površini zlatne elektrode. Osim toga, procijenjeno je da je veličina nanoheksagona u rasponu između 450 i 550 nm s ujednačenom gustoćom i prostornom raspodjelom. U principu, promjer i dužina uzgojenih ZnONW -a mogu se podesiti finom kontrolom parametara procesa rasta, kao što su koncentracija otopine sjemena, stehiometrija reagensa, temperatura i pH otopine za rast [21] [22] . Štaviše, slika FESEM nakon imobilizacije sonde ssDNA prikazana je na slici 1 (B). Kao što je jasno prikazano na ovoj slici, imobilizacija ssDNA na elektrodu modificiranu ZnONWs rezultirala je homogenom pokrivenošću. Može se zaključiti da je struktura ZnONW -a pružila dobru platformu za imobilizaciju ssDNA.

Slika 1. FESEM slika uzgojenih nanožica cinkovog oksida (ZnONW) na površini zlatne elektrode (A) i imobilizirane ssDNA na površinu ZnONW -ove modificirane zlatne elektrode (B).

3.2. Konformacija imobilizacije sonde ssDNA i hibridizacija ciljane ssDNA na ZnO NWs modificiranu zlatnu elektrodu.

Hibridizacija imobilizirane ssDNA sonde s komplementarnom ssDNA (meta) proučavana je diferencijalnom pulsnom voltametrijom. Na slici 2 prikazani su odgovori DPV -a dobiveni za različite osjetljive površine (krivulje c, e i f) i nakon hibridizacije s različitim metama DNA (krivulje a, b i d). S druge strane, nisu zabilježeni nikakvi vidljivi vrhovi kada je DPV proveden na Au elektrodi (krivulja f) kada su izvršena voltametrijska mjerenja na ZnONWs/Au elektrodi modificiranoj ssDNA (od odjeljka 2.4), jasan oksidacijski vrh na 0,94 V i ramena na ca. Zabilježeno je 0,62 V. Ova dva vrha su vjerovatno povezana s oksidacijom adeninske i gvaninske baze (0,94 V) baze DNK sonde. Kao što se može vidjeti iz krivulje a, hibridizacija s komplementarnom metom rezultirala je velikim širim vrhom na ca. 0,8 V [23] [24]. Nisu zabilježeni vrhovi kada je izvršena hibridizacija sa neusklađenim sekvencama (krive b i d) koje potvrđuju specifičnost razvijenog genosenzora. Nadalje, iz krivulje c, ovo je pokazalo da je prisustvo sonde ssDNA ključno za izvođenje hibridacije DNA s njenom metom jer nismo primijetili elektrokemijski odgovor u njenom odsustvu. Gore prikazani rezultati pokazali su da je proces hibridizacije na razvijenoj površini senzora vrlo selektivan i da se odvijao samo u prisutnosti potpuno komplementarne mete. Povrh toga, zabilježen je značajan elektrokemijski odgovor kada je komplementarna DNK hibridizirana na površinu senzora.

3.3. Učinak opterećenja DNK cilja na odgovor biosenzora DNK

Slika 3 prikazuje DNK biosenzorski odgovor s različitim koncentracijama DNA mete, hibridiziran 90 minuta. na površini senzora. Dobro definirani signali hibridizacije primijećeni su u rasponu koncentracija od 10 - 100 & microM ciljne DNA. Nakon daljnjeg povećanja ciljane koncentracije (> 100 & microM), hibridizacija DNA signala se blago smanjila ukazujući na to da je postignuta zasićenje površine. Tako je 100 & microM odabrano kao optimalna ciljna koncentracija u reakciji hibridizacije imobilizirane ssDNA na površini ZnO NWs/Au elektrode. To se pripisuje punoj pokrivenosti ZnONWs/Au elektroda pri ovoj koncentraciji.

Slika 2. Diferencijalni impulsni voltamogrami (DPV) koji su dobiveni imobilizacijom 80 & microM ssDNA na površinu ZnONWs modificirane zlatne elektrode nakon što su sonde bile izložene 100 & microM komplementarnoj ili ciljanoj DNK (a), 3 neusklađenosti ili nepotpune ssDNA (b) i ( d), bez imobilizacije ssDNA (c), za golu zlatnu elektrodu (e) i ZnO NW modifikovanu zlatnu elektrodu-ssDNA (f). DPV -i su mjereni pri potencijalu skeniranom između 0,4 do 1,16 V sa amplitudom modulacije = 0,025 V, vremenom intervala (t1) = 0,5 s, vremenom modulacije (t2) = 0,05 s i potencijalom koraka = 0,005 V u 0,1 M rastvoru acetatnog pufera na pH 7.

3.4. Ovisnost biosenzorskog odziva o pH

Slika 4 prikazuje utjecaj pH na odziv senzora. U ovom setu eksperimenata genosenor pripremljen prema protokolu opisanom u odjeljku 2.4 hibridiziran je 90 minuta. sa 80 & microM i DPV odzivom zabilježenim za različite pH vrijednosti. Snimljeni odgovor pokazao je maksimum pri pH 7 što ukazuje na optimalni pH za detekciju DNK. Povećani odgovor DNK biosenzora na pH 7 može se opisati efikasnijim procesom hibridizacije. U kiselijim uslovima, reakcija protonacije fosfodiestera DNK može smanjiti rastvorljivost molekula DNK, što na kraju smanjuje hibridizaciju DNK. Osim toga, pod nekim bazičnijim medijem došlo je do smanjenja procesa hibridizacije DNK i stoga je došlo do tendencije stvaranja niže DPV struje.

3.5. Kalibracijske karakteristike i stabilnost DNK biosenzora

Slika 5 prikazuje učinak različitih koncentracija komplementarne DNK na odgovor biosenzora. Linearni odgovor je dobiven kada su koncentracije BRCA1 unutar raspona 10 - 100 & microM. Trenutni odziv se linearno povećao (R 2 = 0,994) sa osjetljivošću od 6,36 & microA ∙ & microM −1 dok je gola zlatna elektroda pokazala nižu osjetljivost (1,97 & microA ∙ & microM -1). Granica detekcije (LOD) BRCA1 razvijene ZnONW modificirane zlatne elektrode zasnovane na biosenzorima, izračunata kao signal slijepe probe plus trostruka standardna devijacija [25], bila je 3,32 & microM. Procijenjeni LOD od 3,79 puta puta 10 −7 M izvijestili su Li i suradnici [3] za hibridizaciju DNA bez oznaka za BRCA1 na temelju jednozidnih grafitnih elektroda s modificiranim nanocijevima. Ovo se može razumjeti da primjena ZnONW -a na našoj modificiranoj zlatnoj elektrodi za hibridizaciju DNA na metu BRCA1 ima tendenciju dati veliku osjetljivost u našem razvijenom biosenzoru.

ZnONW -ova modificirana zlatna elektroda pokazala se kao izvrsna supstrat elektrode za razvoj osjetljivog DNK biosenzora za otkrivanje gena raka dojke BRCA1. Slika FESEM -a pokazala je da je nanostruktura uspješno uzgojena na površini zlatne elektrode prosječnog promjera između 450 - 550 nm i s dobrom orijentacijom. Nadalje, pokazali smo da je direktna elektrokemija DNK upotrebom mjerenja DPV -a prikladna za selektivnu detekciju kratke DNK sekvence povezane s genom BRCA1, kada su DNA sonde hemisorbirane na površini ZnONWs/Au. Prisutnost komplementarne DNK sekvence rezultirala je dobro definiranim vrhom oksidacije na ca. 0,8 V. Optimizirano pH stanje za rad biosenzora DNA bilo je na pH 7. Odgovor razvijenog biosenzora DNA bio je linearan u okviru dopunskih ciljnih koncentracija između 10 - 100 & microM. Osim toga, LOD je dobiven na li-

Slika 3. Struja proizvedena hibridizacijom DNA 80 & mikroM imobilizirane ssDNA na ZnONW modificiranoj zlatnoj elektrodi do cilja (BRCA1) u različitim koncentracijama (10 do 120 & microM). Signal DPV struja izmjeren je pri potencijalu skeniranom između 0,4 do 1,16 V s amplitudom modulacije = 0,025 V, vremenom intervala (t1) = 0,5 s, vremenom modulacije (t2) = 0,05 s i koračnim potencijalom = 0,005 V u 0,1 M rastvori acetatnog pufera (pH 7).

Slika 4. Utjecaj pH na odgovor biosenzora kako pokazuje struja hibridizacije s komplementarnom DNA u 0,1 M ABS -u. Signal DPV struja izmjeren je pri potencijalu skeniranom između 0,4 do 1,16 V s amplitudom modulacije = 0,025 V, vremenom intervala (t1) = 0,5 s, vremenom modulacije (t2) = 0,05 s i koračnim potencijalom = 0,005 V u 0,1 M puferske otopine (pH 3-11).

Slika 5. Grafikon kalibracije koji prikazuje promjene oksidacijskih signala izmjerene u prisutnosti DNK hibridizacije između 80 & microM BRCA1 sonde i različitih nivoa koncentracije BRCA1 meta. Signal DPV struja mjeren je pri potencijalu skeniranom između 0,4 do 1,16 V s amplitudom modulacije = 0,025 V, intervalno vrijeme (t1) = 0,5 s, vrijeme modulacije (t2) = 0,05 s i potencijal koraka = 0,005 V u 0,1 M otopinama pufera (pH 7).

skoro odgovor razvijene metode, za koji je utvrđeno da je 3,32 & microM.

Ovim putem želimo zahvaliti Ministarstvu visokog obrazovanja Malezije na ERGS bespovratnoj pomoći (600/RMI/st/ERGS/5/3/fst12/2011) i Universiti Teknologi MARA na finansijskoj podršci putem asistenta za postdiplomske nastavnike (UPTA) Nur Azimah Mansor za provođenje ovog istraživanja.

Nur AzimahMansor, Zainiharyati MohdZain, Hairul HishamHamzah, Mohd Shihabuddin AhmadNoorden, Siti SafuraJaapar, ValerioBeni, Zafar HusainIbupoto, (2014) Otkrivanje raka dojke 1 (BRCA1) na osnovu genetičke biogeneze pomoću biogeneze DNA Otvoreni časopis primijenjenog biosenzora,03, 9-17. doi: 10.4236/ojab.2014.32002


UV apsorpcija i emisiona spektroskopija

UV-vis apsorpcijski i emisijski spektri snimljeni su na Agilent Technologies Cary seriji UV-vis-NIR apsorbancije i fluorescentnim spektrofotometrima Cary eclipse, respektivno koristeći kvarcne kivete dužine 10 mm. Apsorpcijski spektri su skenirani od 230 do 800 nm. Titracije emisije fluorescencije provedene su u 20 mM PBS (100 mM KCl/NaCl), pH 7,4 koristeći 1 μM TGP18 s postupnim dodavanjem različitih prethodno žarenih GQ i dupleksnih DNK dok se ne postigne zasićenje. Talasna dužina pobude za TGP18 je fiksirana na 560 nm, a talasna dužina emisije je skenirana sa 570 nm na 800 nm. Prorezi za pobudu i emisiju postavljeni su na 5 nm. Normalizirane promjene fluorescencije TGP18 zabilježene su i korištene za izračunavanje konstante disocijacije (KD) vrijednost iscrtavanjem promjene fluorescencije (∆F/∆Fmax) na 640 nm u odnosu na povećanje koncentracije TGP18. Dobivene eksperimentalne točke podataka uklopljene su u jednu jednadžbu vezivanja specifičnu za mjesto:

gdje ∆F/∆Fmax = Promjena fluorescencije, L = GQ koncentracija i KD = konstanta disocijacije. Sličan eksperiment izveden je sa dupleksnom DNK, gdje je 1 μM TGP18 titriran sa povećanjem koncentracija dupleksne DNK (0-30 μM). LOD vrijednost izračunata je pomoću jednadžbe LOD = K × Sb/m, gdje je K numerički faktor odabran prema željenoj razini pouzdanosti, Sb standardna devijacija slijepih mjerenja (n = 3) i m osetljivost kalibracione krive [48].


Materijali i metode

Opći postupak za sintezu polimera 3.

U otopinu 2-etil-2-oksazolina (3,97 g, 40 mmol) u klorobenzenu (10 ml) na sobnoj temperaturi brzo je ali pažljivo dodan metil triflat (MeOTf, 197 μL, 1,8 mmol). Smjesa se zatim zagrijavala na 80 ° C 1 sat, a zatim se brzo ohladila potapanjem tikvice u suhi led. Zatim je 4 ml 5% -tne otopine natrij karbonata dodano u rastvor polimera, te je smjesa miješana 30 min. Vodeni sloj je odvojen, a organski sloj ekstrahovan 5% rastvorom natrijum karbonata. Vodeni slojevi su odvojeni, spojeni i miješani preko noći na sobnoj temperaturi da hidroliziraju krajnji oksazolinijev kation. Mutna smjesa je zakiseljena razrijeđenom HCl da se dobije bistra otopina pH <6, a zatim je ekstrahirana metilen kloridom. Kombinirani organski slojevi su osušeni bezvodnim magnezijevim sulfatom i zatim koncentrirani. Bijela čvrsta supstanca istaložena je dodavanjem kap po kap dietil etra u koncentriranu otopinu, a krutina je sakupljena filtriranjem i osušena preko noći u vakuumskoj peći kako bi se dobio željeni polimer 1 (n ≈ 23) (3,1 g, prinos 78%). 1 H NMR (400 MHz, CD3OD) δ 3,51–3,70 (m, 4H, N-CH2-CH2-), 2,96–3,10 (m, 0,127 H, H3C-N), 2,36-2,47 (m, 2H, C (O) -CH2-CH3), 1.10–1.11 (m, 3H, -CH2-CH3). Do suspenzije linearnog polietilenimina dobivenog polimerizacijom oksazolina (1, 1 g, n ≈ 23) u 10 mL vode dodano je 15 mL koncentrirane (35%) HCl. Reakcijska smjesa je zagrijavana na 100 ° C 48 h da se uklone propionilne grupe. Višak klorovodika uklonjen je pod sniženim tlakom, a preostala bijela krutina otopljena je u 10 mL vode. Dobivena smjesa je postala alkalna dodavanjem vodenog rastvora natrijum hidroksida, a nastali bijeli talog je filtriran i ispran vodom da bi se dobio željeni proizvod linearni polietilenimin 2 (230 mg, prinos 53%). 1 H NMR (400 MHz, CD3OD) δ 2,77 (s, 4H, NH-CH2-CH2-). Do suspenzije polimera 2 (200 mg, 4,65 mmol, n ≈ 23) u 10 mL deionizirane vode dodano je 4 (5)-(hidroksimetil) imidazol (1,04 g, 10,6 mmol) i kalijev karbonat (4,4 g, 31,9 mmol). Reakcijska smjesa je zagrijavana na 100 ° C 24 sata, a zatim ohlađena na sobnu temperaturu. Ostatak je stavljen u cijev za dijalizu i dijaliziran protiv sljedećih otapala (svakih 12 do približno 24 sata): 50% metanola u vodi, 25% metanola u vodi i vode. Konačni ostatak je uparen i osušen kako bi se dobio željeni proizvod 3 kao hidroskopska smeđa krutina (281 mg, prinos 49%) (omjer kalemljenja:> 95% etileniminskih jedinica, prema 1H integraciji). 1 H NMR (400 MHz, CD3OD) δ 7,60–7,61 (m, 1H, imidazol), 6,69–6,96 (m, 1H, imidazol), 3,91 (m, 1H, N-CH2-C), 3,60 (m, 1H, N-CH2-C), 2,60-2,67 (m, 4H, NH-CH2-CH2-). Detaljan opis materijala i metoda, sintetičkih postupaka i karakterizacijskih spektara dan je u SI Text.

Kiselo-bazna titracija.

Puferski kapaciteti polimera 2 i 3 su određene kiselinsko-baznom titracijom. Zatim 0,25 mmol 2 ili 3 (koncentracija etileniminskih jedinica) dodano je u 6 ml deionizirane vode, a zatim je u suspenziju dodano 5 ml 0,1 N HCl kako bi se dobila bistra otopina i podesio pH na ca. 2. Zatim su otopini uzastopno dodavani dijelovi od 200 μL 0,05 M NaOH, a pH je mjeren nakon svakog dodavanja sa UltraBASIC Benchtop pH-metrom (UB-5) sa staklenom pH elektrodom od UltraBasic stakla.

Određivanje vežuće aktivnosti.

UV spektri su zabilježeni na sobnoj temperaturi, u odnosu na poli (U) (180 nmol u U) i polimer 3 (n ≈ 23) otopljeno u 5 mL 10 mM fosfatnog pufera (Na2HPO4-NaH2PO4) na pH 7,55. CD spektri su snimljeni na sobnoj temperaturi, u odnosu na poli (U) (375 nmol u U) i polimer 3 (n ≈ 23) direktno otopljen u 5 mL 10 mM fosfatnog pufera (Na2HPO4-NaH2PO4) na pH 7,5.

Enzimski kinetički test.

Pufer A odnosi se na pH 7,00 (25 ° C), 0,125 M Trizma® [tris- (hidroksimetil) -aminometana] baza/jantarna kiselina, 0,125 M NaCl, 18,8 mM MgCl2. Puferi za reakciju cijepanja napravljeni su od Trizma® baze/Trizma® hidroklorida. Jonska snaga je podešena na 0,1 M pomoću natrijum hlorida. PH reakcijske otopine izmjeren je prije reakcije na 25 ° C i ekstrapoliran na 80 ° C, temperaturu reakcije, uz pomoć poznate temperaturne ovisnosti. Svi puferi su držani zamrznuti prije upotrebe. Reakcijske otopine pripremljene su kombiniranjem odgovarajuće količine poli (U), strnatrijeva sol -nitrobenzensulfonske kiseline kao interni standard, polimerni katalizatori i puferska otopina da se dobije reakcijska smjesa (za polivinilimidazole, 30% etanol u otopini Trizma-HCl korišten je kao pufer). U odgovarajućim intervalima, uzorci su uklonjeni iz reakcijske smjese, ohlađeni na sobnu temperaturu i odmah tretirani otopinom otrovne fosfodiesteraze I (približno 25 jedinica · mL -1 u puferu A). Cijev je začepljena, snažno miješana i uronjena u termički uravnoteženi grijač na 40 ° C. Nakon 6 sati inkubacije, uzorci su uklonjeni i stavljeni u suhi led dok ne budu spremni za analizu pomoću HPLC. Koncentracije uridina u reakcijskim uzorcima izračunate su iz prethodno dobivene jednadžbe pomoću početne koncentracije standarda. Konstanta brzine pseudo-prvog reda kobs za cijepanje je dobiveno dijeljenjem nagiba parcele [Uridine] u odnosu na vrijeme početnom koncentracijom poli (U). Reprezentativna procedura, obrada HPLC spektra uzorka cijepanja i rezultati su opisani u SI Text.


Pogledajte video: Nucleotides u0026 their Formation. Biomolecules in Tamil 13 (Januar 2022).